Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

999

Name

CDH1

Synonym

Arc-1|CD324|CDHE|ECAD|LCAM|UVO;cadherin 1, type 1, E-cadherin (epithelial);CDH1;cadherin 1, type 1, E-cadherin (epithelial)

Definition

CAM 120/80|E-Cadherin|cadherin 1, E-cadherin (epithelial)|cadherin-1|calcium-dependent adhesion protein, epithelial|cell-CAM 120/80|epithelial cadherin|uvomorulin

Position

16q22.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Integrin cell surface interactions;PID Reactome;500004

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514

Pathway

tgf beta signaling pathway;PID BioCarta;100017

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell;PID Reactome;500477

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

downregulated of mta-3 in er-negative breast tumors;PID BioCarta;100102

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

E-cadherin signaling events;PID Curated;200094

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Arf6 trafficking events;PID Curated;200046

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

sumoylation as a mechanism to modulate ctbp-dependent gene responses;PID BioCarta;100195

Pathway

Apoptotic cleavage of cell adhesion proteins;PID Reactome;500272

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

urothelial cancer;GAD

Disease

urinary calculus;GAD

Disease

bladder cancer;GAD

Disease

Breast cancer, lobular;OMIM

Disease

Endometrial carcinoma;OMIM

Disease

Cleft lip with or without cleft palate, with gastric cancer, familial diffuse;OMIM

Disease

IMMUNE;GAD

Disease

transitional cell carcinoma of the bladder.;GAD

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

prostate cancer;GAD

Disease

METABOLIC;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Ulcerative colitis;NHGRI

Disease

gastric carcinoma risk;GAD

Disease

colorectal cancer;GAD

Disease

Breast cancer;KEGG DISEASE;H00031

Disease

Gastric cancer, familial diffuse;OMIM

Disease

Hepatocellular carcinoma;KEGG DISEASE;H00048

Disease

Crohn Disease;GAD

Disease

Penile cancer;KEGG DISEASE;H00025

Disease

CANCER;GAD

Disease

Colorectal cancer;NHGRI

Disease

Ovarian carcinoma;OMIM

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Listeria monocytogenes, susceptibility to;OMIM

Disease

Cancers;KEGG DISEASE

Disease

diffuse gastric cancer;GAD

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Nasopharyngeal cancer;KEGG DISEASE;H00054

Disease

Head and neck cancers;KEGG DISEASE

Disease

ulcerative colitis;GAD

Disease

stomach cancer;GAD

External Links

Links to Entrez Gene

999

Links to all GeneRIF Items

999

Links to iHOP

999

Sequence Information

Nucleotide Sequence

>999 : length: 2649
atgggcccttggagccgcagcctctcggcgctgctgctgctgctgcaggtctcctcttgg
ctctgccaggagccggagccctgccaccctggctttgacgccgagagctacacgttcacg
gtgccccggcgccacctggagagaggccgcgtcctgggcagagtgaattttgaagattgc
accggtcgacaaaggacagcctatttttccctcgacacccgattcaaagtgggcacagat
ggtgtgattacagtcaaaaggcctctacggtttcataacccacagatccatttcttggtc
tacgcctgggactccacctacagaaagttttccaccaaagtcacgctgaatacagtgggg
caccaccaccgccccccgccccatcaggcctccgtttctggaatccaagcagaattgctc
acatttcccaactcctctcctggcctcagaagacagaagagagactgggttattcctccc
atcagctgcccagaaaatgaaaaaggcccatttcctaaaaacctggttcagatcaaatcc
aacaaagacaaagaaggcaaggttttctacagcatcactggccaaggagctgacacaccc
cctgttggtgtctttattattgaaagagaaacaggatggctgaaggtgacagagcctctg
gatagagaacgcattgccacatacactctcttctctcacgctgtgtcatccaacgggaat
gcagttgaggatccaatggagattttgatcacggtaaccgatcagaatgacaacaagccc
gaattcacccaggaggtctttaaggggtctgtcatggaaggtgctcttccaggaacctct
gtgatggaggtcacagccacagacgcggacgatgatgtgaacacctacaatgccgccatc
gcttacaccatcctcagccaagatcctgagctccctgacaaaaatatgttcaccattaac
aggaacacaggagtcatcagtgtggtcaccactgggctggaccgagagagtttccctacg
tataccctggtggttcaagctgctgaccttcaaggtgaggggttaagcacaacagcaaca
gctgtgatcacagtcactgacaccaacgataatcctccgatcttcaatcccaccacgtac
aagggtcaggtgcctgagaacgaggctaacgtcgtaatcaccacactgaaagtgactgat
gctgatgcccccaataccccagcgtgggaggctgtatacaccatattgaatgatgatggt
ggacaatttgtcgtcaccacaaatccagtgaacaacgatggcattttgaaaacagcaaag
ggcttggattttgaggccaagcagcagtacattctacacgtagcagtgacgaatgtggta
ccttttgaggtctctctcaccacctccacagccaccgtcaccgtggatgtgctggatgtg
aatgaagcccccatctttgtgcctcctgaaaagagagtggaagtgtccgaggactttggc
gtgggccaggaaatcacatcctacactgcccaggagccagacacatttatggaacagaaa
ataacatatcggatttggagagacactgccaactggctggagattaatccggacactggt
gccatttccactcgggctgagctggacagggaggattttgagcacgtgaagaacagcacg
tacacagccctaatcatagctacagacaatggttctccagttgctactggaacagggaca
cttctgctgatcctgtctgatgtgaatgacaacgcccccataccagaacctcgaactata
ttcttctgtgagaggaatccaaagcctcaggtcataaacatcattgatgcagaccttcct
cccaatacatctcccttcacagcagaactaacacacggggcgagtgccaactggaccatt
cagtacaacgacccaacccaagaatctatcattttgaagccaaagatggccttagaggtg
ggtgactacaaaatcaatctcaagctcatggataaccagaataaagaccaagtgaccacc
ttagaggtcagcgtgtgtgactgtgaaggggccgctggcgtctgtaggaaggcacagcct
gtcgaagcaggattgcaaattcctgccattctggggattcttggaggaattcttgctttg
ctaattctgattctgctgctcttgctgtttcttcggaggagagcggtggtcaaagagccc
ttactgcccccagaggatgacacccgggacaacgtttattactatgatgaagaaggaggc
ggagaagaggaccaggactttgacttgagccagctgcacaggggcctggacgctcggcct
gaagtgactcgtaacgacgttgcaccaaccctcatgagtgtcccccggtatcttccccgc
cctgccaatcccgatgaaattggaaattttattgatgaaaatctgaaagcggctgatact
gaccccacagccccgccttatgattctctgctcgtgtttgactatgaaggaagcggttcc
gaagctgctagtctgagctccctgaactcctcagagtcagacaaagaccaggactatgac
tacttgaacgaatggggcaatcgcttcaagaagctggctgacatgtacggaggcggcgag
gacgactag

Protein Sequence

>999 : length: 882
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD



')