Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9953

Name

HS3ST3B1

Synonym

30ST3B1|3OST3B1;heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1;HS3ST3B1;heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1

Definition

3-OST-3B|h3-OST-3B|heparan sulfate 3-O-sulfotransferase 3B1|heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1|heparan sulfate glucosamine 3-O-sulfotransferase 3B1

Position

17p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Glycosaminoglycan biosynthesis - heparan sulfate;KEGG PATHWAY;hsa00534

Pathway

heparan sulfate biosynthesis;BioCyc;PWY-6564

Pathway

heparan sulfate biosynthesis (late stages);BioCyc;PWY-6558

Disease

protein quantitative trait loci;GAD

Disease

Protein quantitative trait loci;NHGRI

External Links

Links to Entrez Gene

9953

Links to all GeneRIF Items

9953

Links to iHOP

9953

Sequence Information

Nucleotide Sequence

>9953 : length: 1173
atggggcagcgcctgagtggcggcagatcttgcctcgatgtccccggccggctcctaccg
cagccgccgccgcccccgccgccggtgaggaggaagctcgcgctgctcttcgccatgctc
tgcgtctggctctatatgttcctgtactcgtgcgccggctcctgcgccgccgcgccgggg
ctgctgctcctgggctctgggtcccgcgccgcacacgacccgccagccctggccacagct
ccggacgggacgccccccaggctgccgttccgggcgccgccagccaccccactggcttca
ggcaaggagatggccgagggcgctgcgagcccggaggagcagagtcccgaggtgccggac
tccccaagccccatctccagctttttcagtgggtctgggagcaagcagctgccgcaggcc
atcatcatcggcgtgaagaagggcggcacgcgggcgctgctggagtttctgcgcgtgcac
cccgacgtgcgcgccgtgggcgccgagccccatttcttcgatcgcagctacgacaagggc
ctcgcttggtaccgggacctgatgcccagaaccctggacgggcagatcaccatggagaag
acgcccagttacttcgtcacgcgggaggcccccgcgcgcatctcggccatgtccaaggac
accaagctcatcgtggtggtgcgggacccggtgaccagggccatctcggactacacgcag
acgctgtccaagcggcccgacatccccaccttcgagagcttgacgttcaaaaacaggaca
gcgggcctcatcgacacgtcgtggagcgccatccagatcggcatctacgccaagcacctg
gagcactggctgcgccacttccccatccgccagatgctcttcgtgagcggcgagcggctc
atcagcgacccggccggggagctgggccgcgtgcaagacttcctgggcctcaagaggatc
atcacggacaagcacttctacttcaacaagaccaagggcttcccctgcctgaagaaggcg
gagggcagcagccggccccattgcctgggcaagaccaagggcaggacccatcctgagatc
gaccgcgaggtggtgcgcaggctgcgcgagttctaccggcctttcaacctcaagttctac
cagatgaccgggcacgactttggctgggattga

Protein Sequence

>9953 : length: 390
MGQRLSGGRSCLDVPGRLLPQPPPPPPPVRRKLALLFAMLCVWLYMFLYSCAGSCAAAPG
LLLLGSGSRAAHDPPALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPD
SPSPISSFFSGSGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKG
LAWYRDLMPRTLDGQITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQ
TLSKRPDIPTFESLTFKNRTAGLIDTSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERL
ISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSRPHCLGKTKGRTHPEI
DREVVRRLREFYRPFNLKFYQMTGHDFGWD



')