Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9839

Name

ZEB2

Synonym

HSPC082|SIP-1|SIP1|SMADIP1|ZFHX1B;zinc finger E-box binding homeobox 2;ZEB2;zinc finger E-box binding homeobox 2

Definition

SMAD interacting protein 1|Smad-interacting protein 1|zinc finger E-box-binding homeobox 2|zinc finger homeobox 1b

Position

2q22.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

9839

Links to all GeneRIF Items

9839

Links to iHOP

9839

Sequence Information

Nucleotide Sequence

>9839 : length: 3573
atgaagcagccgatcatggcggatggcccccggtgcaagaggcgcaaacaagccaatccc
aggaggaaaaacgtggtgaactatgacaatgtagtggacacaggttctgaaacagatgag
gaagacaagcttcatattgctgaggatgacggtattgccaaccctctggaccaggagacg
agtccagctagtgtgcccaaccatgagtcctccccacacgtgagccaagctctgttgcca
agagaggaagaggaagatgaaataagggagggtggagtggaacacccctggcacaacaac
gagattctacaagcctctgtagatggtccagtgaagaatgcaaattgcacatcagatttt
gaggaatactttgccaaaagaaaactggaggaacgcgatggtcatgcagtcagcatcgag
gagtaccttcagcgcagtgacacagccattatttacccagaagcccctgaggagctgtct
cgccttggcacgccagaggccaatgggcaagaagaaaatgacctgccacctggaactcca
gatgcttttgcccaactgctgacctgcccctactgcgaccggggctacaagcgcttgaca
tcactgaaggagcacatcaagtaccgccacgagaagaatgaagagaacttttcctgccct
ctctgtagctacacgtttgcctaccgcacccagctcgagcggcatatggtgacacacaag
ccagggacagatcagcaccaaatgctaacccaaggagcaggtaatcgcaagttcaaatgc
acagagtgtggcaaggccttcaaatataaacaccatctgaaagaacacctgcgaattcac
agtggtgaaaaaccttacgagtgcccaaactgcaagaaacgtttctcccattctggttcc
tacagttcgcacatcagcagcaagaaatgtattggtttaatctctgtaaatggccgaatg
agaaacaatatcaagacgggttcttcccctaattctgtttcttcttctcctactaattca
gccattacccagttaagaaacaagttggagaatggaaaaccacttagtatgtctgaacag
acaggcttacttaaaattaaaacagaaccactagacttcaatgactataaagttcttatg
gctacacacgggtttagtggcactagtccctttatgaatggtgggcttggagccaccagc
cctttaggagttcatccatctgctcagagtccaatgcagcacttaggtgtagggatggaa
gcccctttacttgggtttcccaccatgaatagtaatttaagtgaggtacaaaaggttcta
cagattgtggacaatactgtttccaggcaaaaaatggactgcaaggctgaagaaatttca
aagttgaaaggttatcacatgaaggatccatgctctcaacctgaggaacaaggagttact
tctcctaatattccgcctgtcggtcttccggtagtgagtcataatggtgccactaaaagt
attattgactatacgttggaaaaagtcaatgaagccaaagcttgcctccagagcttgact
actgactcaaggagacagatcagtaatataaagaaagagaagctacgtactttaatagat
ttggtcactgatgacaaaatgattgagaaccacaacatatccactccattttcatgccag
ttctgtaaagaaagttttcctggccccatccctttgcatcagcatgaacgttacctttgt
aagatgaatgaagagatcaaggcggtcctgcagcctcatgaaaacatagtccccaacaaa
gccggagtttttgttgataataaagccctcctcttgtcatctgtactttctgagaaagga
atgacaagccccatcaacccatacaaggaccacatgtctgtactcaaagcatactatgct
atgaacatggagcccaactccgatgaactgctgaaaatttccattgctgtgggccttcct
caggaatttgtgaaggaatggtttgaacaacgaaaagtctaccagtactcaaattccagg
tccccatccctggaaagaagctccaagccgttagctcccaacagtaaccctcccacaaaa
gactctttattacccaggtctcctgtaaaacctatggactccataacatcaccatctata
gcagaactccacaacagtgttacgaattgtgatcctcctctcaggctaacaaaaccttcc
cattttaccaatattaaaccagttgaaaaattggaccactccaggagtaatactccttct
cccttaaatctttcctccacatcttctaaaaactcccacagtagttcatacactccaaac
agcttctcttctgaggagctccaggctgagcctttagacttgtcattaccaaaacaaatg
aaagaacccaaaagtattatagccacaaagaacaaaacaaaagctagtagcatcagttta
gatcataacagtgtttcttcctcatctgaaaactcagatgagcctctgaacttgactttt
atcaagaaggaattttcaaattcaaataatctggacaacaaaagcactaacccagtgttc
agcatgaacccatttagtgccaaacctttatacacagctcttccacctcaaagcgcattt
ccccctgctactttcatgccaccagtccagaccagtattcctgggctacgaccataccca
ggactggatcagatgagcttcctaccacatatggcctacacctacccaactggagcagct
acttttgctgatatgcagcaaaggagaaagtaccagcggaaacaaggatttcagggagaa
ttgcttgatggagcacaagactacatgtcaggcctagatgatatgacagactccgactcc
tgtctgtctcgcaaaaagatcaagaagacagagagtggcatgtatgcatgtgacttatgt
gacaagacattccagaaaagcagttcccttctgcgacataaatacgaacacacaggaaaa
agaccacatcagtgtcagatttgtaagaaagcgtttaaacacaagcaccaccttatcgag
cactcaaggcttcactcgggcgagaagccctatcagtgtgataaatgtggcaagcgcttc
tcacactcgggctcgtactcgcagcacatgaatcacaggtattcctactgcaagcgggag
gcggaggagcgggaagcggcggagcgcgaggcgcgcgagaaagggcacttggaacccacc
gagctgctgatgaaccgggcttacttgcagagcattacccctcaggggtactctgactcg
gaggagagggagagtatgccgagggatggcgagagcgagaaggagcacgagaaagaaggc
gaggatggctacgggaagctgggcagacaggatggcgacgaggagttcgaggaggaagag
gaagaaagtgaaaataaaagtatggatacggatcccgaaacgatacgagatgaagaagag
actggagatcactccatggacgatagttcggaggatgggaaaatggaaaccaaatcagac
cacgaggaagacaatatggaagatggcatgtaa

Protein Sequence

>9839 : length: 1190
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQET
SPASVPNHESSPHVSQALLPREEEEDEIREGGVEHPWHNNEILQASVDGPVKNANCTSDF
EEYFAKRKLEERDGHAVSIEEYLQRSDTAIIYPEAPEELSRLGTPEANGQEENDLPPGTP
DAFAQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEENFSCPLCSYTFAYRTQLERHMVTHK
PGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGS
YSSHISSKKCIGLISVNGRMRNNIKTGSSPNSVSSSPTNSAITQLRNKLENGKPLSMSEQ
TGLLKIKTEPLDFNDYKVLMATHGFSGTSPFMNGGLGATSPLGVHPSAQSPMQHLGVGME
APLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKAEEISKLKGYHMKDPCSQPEEQGVT
SPNIPPVGLPVVSHNGATKSIIDYTLEKVNEAKACLQSLTTDSRRQISNIKKEKLRTLID
LVTDDKMIENHNISTPFSCQFCKESFPGPIPLHQHERYLCKMNEEIKAVLQPHENIVPNK
AGVFVDNKALLLSSVLSEKGMTSPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLP
QEFVKEWFEQRKVYQYSNSRSPSLERSSKPLAPNSNPPTKDSLLPRSPVKPMDSITSPSI
AELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPN
SFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSENSDEPLNLTF
IKKEFSNSNNLDNKSTNPVFSMNPFSAKPLYTALPPQSAFPPATFMPPVQTSIPGLRPYP
GLDQMSFLPHMAYTYPTGAATFADMQQRRKYQRKQGFQGELLDGAQDYMSGLDDMTDSDS
CLSRKKIKKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKHHLIE
HSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEEREAAEREAREKGHLEPT
ELLMNRAYLQSITPQGYSDSEERESMPRDGESEKEHEKEGEDGYGKLGRQDGDEEFEEEE
EESENKSMDTDPETIRDEEETGDHSMDDSSEDGKMETKSDHEEDNMEDGM



')