Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9723

Name

SEMA3E

Synonym

M-SEMAH|M-SemaK|SEMAH|coll-5;sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E;SEMA3E;sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E

Definition

semaphorin-3E

Position

7q21.11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Other semaphorin interactions;PID Reactome;500078

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Axon guidance;Reactome;REACT:18266

Disease

CHARGE syndrome;OMIM

External Links

Links to Entrez Gene

9723

Links to all GeneRIF Items

9723

Links to iHOP

9723

Sequence Information

Nucleotide Sequence

>9723 : length: 2148
atgctgctggatgaatatcaagagaggctcttcgtgggaggcagggaccttgtatattcc
ctcagcttggagagaatcagtgacggctataaagagatacactggccgagtacagctcta
aaaatggaagaatgcataatgaagggaaaagatgcgggtgaatgtgcaaattatgttcgg
gttttgcatcactataacaggacacaccttctgacctgtggtactggagcttttgatcca
gtttgtgccttcatcagagttggatatcatttggaggatcctctgtttcacctggaatca
cccagatctgagagaggaaggggcagatgtccttttgaccccagctcctccttcatctcc
actttaattggtagtgaattgtttgctggactctacagtgactactggagcagagacgct
gcgatcttccgcagcatggggcgactggcccatatccgcactgagcatgacgatgagcgt
ctgttgaaagaaccaaaatttgtaggttcatacatgattcctgacaatgaagacagagat
gacaacaaagtatatttcttttttactgagaaggcactggaggcagaaaacaatgctcac
gcaatttacaccagggtcgggcgactctgtgtgaatgatgtaggagggcagagaatactg
gtgaataagtggagcactttcctaaaagcgagactcgtttgctcagtaccaggaatgaat
ggaattgacacatattttgatgaattagaggacgtttttttgctacctaccagagatcat
aagaatccagtgatatttggactctttaacactaccagtaatatttttcgagggcatgct
atatgtgtctatcacatgtctagcattcgggcagccttcaacggaccatatgcacataag
gaaggacctgaataccactggtcagtctatgaaggaaaagtcccttatccaaggcctggt
tcttgtgccagcaaagtaaatggagggagatacggaaccaccaaggactatcctgatgat
gccatccgatttgcaagaagtcatccactaatgtaccaggccataaaacctgcccataaa
aaaccaatattggtaaaaacagatggaaaatataacctgaaacaaatagcagtagatcga
gtggaagctgaggatggccaatatgacgtcttgtttattgggacagataatggaattgtg
ctgaaagtaatcacaatttacaaccaagaaatggaatcaatggaagaagtaattctagaa
gaacttcagatattcaaggatccagttcctattatttctatggagatttcttcaaagcgg
caacagctgtatattggatctgcttctgctgtggctcaagtcagattccatcactgtgac
atgtatggaagtgcttgtgctgactgctgcctggctcgagacccttactgtgcctgggat
ggcatatcctgctcccggtattacccaacaggcacacatgcaaaaaggcgtttccggaga
caagatgttcgacatggaaatgcagctcagcagtgctttggacaacagtttgttggggat
gctttggataagactgaagaacatctggcttatggcatagagaacaacagtactttgctg
gaatgtaccccacgatctttacaagcgaaagttatctggtttgtacagaaaggacgtgag
acaagaaaagaggaggtgaagacagatgacagagtggttaagatggaccttggtttactc
ttcctaaggttacacaaatcagatgctgggacctatttttgccagacagtagagcatagc
tttgtccatacggtccgtaaaatcaccttggaggtagtggaagaggagaaagtcgaggat
atgtttaacaaggacgatgaggaggacaggcatcacaggatgccttgtcctgctcagagt
agcatctcgcagggagcaaaaccatggtacaaggaattcttgcagctgatcggttatagc
aacttccagagagtggaagaatactgcgagaaagtatggtgcacagatagaaagaggaaa
aagcttaaaatgtcaccctccaagtggaagtatgccaaccctcaggaaaagaagctccgt
tccaaacctgagcattaccgcctgcccaggcacacgctggactcctga

Protein Sequence

>9723 : length: 715
MLLDEYQERLFVGGRDLVYSLSLERISDGYKEIHWPSTALKMEECIMKGKDAGECANYVR
VLHHYNRTHLLTCGTGAFDPVCAFIRVGYHLEDPLFHLESPRSERGRGRCPFDPSSSFIS
TLIGSELFAGLYSDYWSRDAAIFRSMGRLAHIRTEHDDERLLKEPKFVGSYMIPDNEDRD
DNKVYFFFTEKALEAENNAHAIYTRVGRLCVNDVGGQRILVNKWSTFLKARLVCSVPGMN
GIDTYFDELEDVFLLPTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIRAAFNGPYAHK
EGPEYHWSVYEGKVPYPRPGSCASKVNGGRYGTTKDYPDDAIRFARSHPLMYQAIKPAHK
KPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDNGIVLKVITIYNQEMESMEEVILE
ELQIFKDPVPIISMEISSKRQQLYIGSASAVAQVRFHHCDMYGSACADCCLARDPYCAWD
GISCSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLL
ECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVKMDLGLLFLRLHKSDAGTYFCQTVEHS
FVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCPAQSSISQGAKPWYKEFLQLIGYS
NFQRVEEYCEKVWCTDRKRKKLKMSPSKWKYANPQEKKLRSKPEHYRLPRHTLDS



')