Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

960

Name

CD44

Synonym

CDW44|CSPG8|ECMR-III|HCELL|HUTCH-I|IN|LHR|MC56|MDU2|MDU3|MIC4|Pgp1;CD44 molecule (Indian blood group);CD44;CD44 molecule (Indian blood group)

Definition

CD44 antigen|GP90 lymphocyte homing/adhesion receptor|Hermes antigen|cell surface glycoprotein CD44|chondroitin sulfate proteoglycan 8|epican|extracellular matrix receptor III|hematopoietic cell E- and L-selectin ligand|heparan sulfate proteoglycan|homing

Position

11p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Disease

Blood group, Indian system;OMIM

Disease

Cancers;KEGG DISEASE

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Gastric cancer;KEGG DISEASE;H00018

External Links

Links to Entrez Gene

960

Links to all GeneRIF Items

960

Links to iHOP

960

Sequence Information

Nucleotide Sequence

>960 : length: 2229
atggacaagttttggtggcacgcagcctggggactctgcctcgtgccgctgagcctggcg
cagatcgatttgaatataacctgccgctttgcaggtgtattccacgtggagaaaaatggt
cgctacagcatctctcggacggaggccgctgacctctgcaaggctttcaatagcaccttg
cccacaatggcccagatggagaaagctctgagcatcggatttgagacctgcaggtatggg
ttcatagaagggcacgtggtgattccccggatccaccccaactccatctgtgcagcaaac
aacacaggggtgtacatcctcacatccaacacctcccagtatgacacatattgcttcaat
gcttcagctccacctgaagaagattgtacatcagtcacagacctgcccaatgcctttgat
ggaccaattaccataactattgttaaccgtgatggcacccgctatgtccagaaaggagaa
tacagaacgaatcctgaagacatctaccccagcaaccctactgatgatgacgtgagcagc
ggctcctccagtgaaaggagcagcacttcaggaggttacatcttttacaccttttctact
gtacaccccatcccagacgaagacagtccctggatcaccgacagcacagacagaatccct
gctaccactttgatgagcactagtgctacagcaactgagacagcaaccaagaggcaagaa
acctgggattggttttcatggttgtttctaccatcagagtcaaagaatcatcttcacaca
acaacacaaatggctggtacgtcttcaaataccatctcagcaggctgggagccaaatgaa
gaaaatgaagatgaaagagacagacacctcagtttttctggatcaggcattgatgatgat
gaagattttatctccagcaccatttcaaccacaccacgggcttttgaccacacaaaacag
aaccaggactggacccagtggaacccaagccattcaaatccggaagtgctacttcagaca
accacaaggatgactgatgtagacagaaatggcaccactgcttatgaaggaaactggaac
ccagaagcacaccctcccctcattcaccatgagcatcatgaggaagaagagaccccacat
tctacaagcacaatccaggcaactcctagtagtacaacggaagaaacagctacccagaag
gaacagtggtttggcaacagatggcatgagggatatcgccaaacacccaaagaagactcc
cattcgacaacagggacagctgcagcctcagctcataccagccatccaatgcaaggaagg
acaacaccaagcccagaggacagttcctggactgatttcttcaacccaatctcacacccc
atgggacgaggtcatcaagcaggaagaaggatggatatggactccagtcatagtataacg
cttcagcctactgcaaatccaaacacaggtttggtggaagatttggacaggacaggacct
ctttcaatgacaacgcagcagagtaattctcagagcttctctacatcacatgaaggcttg
gaagaagataaagaccatccaacaacttctactctgacatcaagcaataggaatgatgtc
acaggtggaagaagagacccaaatcattctgaaggctcaactactttactggaaggttat
acctctcattacccacacacgaaggaaagcaggaccttcatcccagtgacctcagctaag
actgggtcctttggagttactgcagttactgttggagattccaactctaatgtcaatcgt
tccttatcaggagaccaagacacattccaccccagtggggggtcccataccactcatgga
tctgaatcagatggacactcacatgggagtcaagaaggtggagcaaacacaacctctggt
cctataaggacaccccaaattccagaatggctgatcatcttggcatccctcttggccttg
gctttgattcttgcagtttgcattgcagtcaacagtcgaagaaggtgtgggcagaagaaa
aagctagtgatcaacagtggcaatggagctgtggaggacagaaagccaagtggactcaac
ggagaggccagcaagtctcaggaaatggtgcatttggtgaacaaggagtcgtcagaaact
ccagaccagtttatgacagctgatgagacaaggaacctgcagaatgtggacatgaagatt
ggggtgtaa

Protein Sequence

>960 : length: 742
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS
GSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQE
TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD
EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWN
PEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS
HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSIT
LQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV
TGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR
SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLAL
ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET
PDQFMTADETRNLQNVDMKIGV



')