Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9500

Name

MAGED1

Synonym

DLXIN-1|NRAGE;melanoma antigen family D, 1;MAGED1;melanoma antigen family D, 1

Definition

MAGE tumor antigen CCF|MAGE-D1 antigen|melanoma-associated antigen D1|neurotrophin receptor-interacting MAGE homolog

Position

Xp11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Role of DCC in regulating apoptosis;PID Reactome;500280

Pathway

NRAGE signals death through JNK;PID Reactome;500609

Disease

CANCER;GAD

Disease

prostate cancer;GAD

Disease

Melanoma;FunDO

Disease

Pancreas cancer;FunDO

Disease

Breast cancer;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to Entrez Gene

9500

Links to all GeneRIF Items

9500

Links to iHOP

9500

Sequence Information

Nucleotide Sequence

>9500 : length: 2337
atggctcagaaaatggactgtggtgcgggcctcctcggcttccaggctgaggcctccgta
gaagacagcgccttgcttatgcagaccttgatggaggccatccagatctcagaggctcca
cctactaaccaggccaccgcagctgctagtccccagagttcacagcccccaactgccaat
gagatggctgacattcaggtttcagcagctgccgctaggcctaagtcagcctttaaagtc
cagaatgccaccacaaaaggcccaaatggtgtctatgatttctctcaggctcataatgcc
aaggatgtgcccaacacgcagcccaaggcagcctttaagtcccaaaatgctaccccaaag
ggtccaaatgctgcctatgatttttcccaggcagcaaccactggtgagttagctgctaac
aagtctgagatggccttcaaggcccagaatgccactactaaagtgggcccaaatgccacc
tacaatttctctcagtctctcaatgccaatgacctggccaacagcaggcctaagacccct
ttcaaggcttggaatgataccactaaggccccaacagctgatacccagacccagaatgta
aatcaggccaaaatggccacttcccaggctgacatagagaccgacccaggtatctctgaa
cctgacggtgcaactgcacagacatcagcagatggttcccaggctcagaatctggagtcc
cggacaataattcggggcaagaggacccgcaagattaataacttgaatgttgaagagaac
agcagtggggatcagaggcgggccccactggctgcagggacctggaggtctgcaccagtt
ccagtgaccactcagaacccacctggcgcaccccccaatgtgctctggcagacgccattg
gcttggcagaacccctcaggctggcaaaaccagacagccaggcagaccccaccagcacgt
cagagccctccagctaggcagaccccaccagcctggcagaacccagtcgcttggcagaac
ccagtgatttggccaaacccagtaatctggcagaacccagtgatctggccaaaccccatt
gtctggcccggccctgttgtctggccgaatccactggcctggcagaatccacctggatgg
cagactccacctggatggcagaccccaccgggctggcagggtcctccagactggcaaggt
cctcctgactggccgctaccacccgactggccactgccacctgattggccacttcccact
gactggccactaccacctgactggatccccgctgattggccaattccacctgactggcag
aacctgcgcccctcgcctaacctgcgcccttctcccaactcgcgtgcctcacagaaccca
ggtgctgcacagccccgagatgtggcccttcttcaggaaagagcaaataagttggtcaag
tacttgatgcttaaggactacacaaaggtgcccatcaagcgctcagaaatgctgagagat
atcatccgtgaatacactgatgtttatccagaaatcattgaacgtgcatgctttgtccta
gagaagaaatttgggattcaactgaaagaaattgacaaagaagaacacctgtatattctc
atcagtacccccgagtccctggctggcatactgggaacgaccaaagacacacccaagctc
ggtctcctcttggtgattctgggtgtcatcttcatgaatggcaaccgtgccagtgaggct
gtcctctgggaggcactacgcaagatgggactgcgtcctggggtgagacatcccctcctt
ggagatctaaggaaacttctcacctatgagtttgtaaagcagaaatacctggactacaga
cgagtgcccaacagcaaccccccggagtatgagttcctctggggcctccgttcctaccat
gagactagcaagatgaaagtgctgagattcattgcagaggttcagaaaagagaccctcgt
gactggactgcacagttcatggaggctgcagatgaggccttggatgctctggatgctgct
gcagctgaggccgaagcccgggctgaagcaagaacccgcatgggaattggagatgaggct
gtgtctgggccctggagctgggatgacattgagtttgagctgctgacctgggatgaggaa
ggagattttggagatccctggtccagaattccatttaccttctgggccagataccaccag
aatgcccgctccagattccctcagacctttgccggtcccattattggtcctggtggtaca
gccagtgccaacttcgctgccaactttggtgccattggtttcttctgggttgagtga

Protein Sequence

>9500 : length: 778
MAQKMDCGAGLLGFQAEASVEDSALLMQTLMEAIQISEAPPTNQATAAASPQSSQPPTAN
EMADIQVSAAAARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPK
GPNAAYDFSQAATTGELAANKSEMAFKAQNATTKVGPNATYNFSQSLNANDLANSRPKTP
FKAWNDTTKAPTADTQTQNVNQAKMATSQADIETDPGISEPDGATAQTSADGSQAQNLES
RTIIRGKRTRKINNLNVEENSSGDQRRAPLAAGTWRSAPVPVTTQNPPGAPPNVLWQTPL
AWQNPSGWQNQTARQTPPARQSPPARQTPPAWQNPVAWQNPVIWPNPVIWQNPVIWPNPI
VWPGPVVWPNPLAWQNPPGWQTPPGWQTPPGWQGPPDWQGPPDWPLPPDWPLPPDWPLPT
DWPLPPDWIPADWPIPPDWQNLRPSPNLRPSPNSRASQNPGAAQPRDVALLQERANKLVK
YLMLKDYTKVPIKRSEMLRDIIREYTDVYPEIIERACFVLEKKFGIQLKEIDKEEHLYIL
ISTPESLAGILGTTKDTPKLGLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGVRHPLL
GDLRKLLTYEFVKQKYLDYRRVPNSNPPEYEFLWGLRSYHETSKMKVLRFIAEVQKRDPR
DWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEAVSGPWSWDDIEFELLTWDEE
GDFGDPWSRIPFTFWARYHQNARSRFPQTFAGPIIGPGGTASANFAANFGAIGFFWVE



')