Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9475

Name

ROCK2

Synonym

ROCK-II;Rho-associated, coiled-coil containing protein kinase 2;ROCK2;Rho-associated, coiled-coil containing protein kinase 2

Definition

p164 ROCK-2|rho-associated protein kinase 2|rho-associated, coiled-coil-containing protein kinase II

Position

2p24

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

ccr3 signaling in eosinophils;PID BioCarta;100215

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Cytoskeletal regulation by Rho GTPase;PANTHER;P00016

Disease

Scleroderma;FunDO

Disease

hypertension;GAD

Disease

Hypertension;FunDO

Disease

Systemic scleroderma;FunDO

Disease

CARDIOVASCULAR;GAD

External Links

Links to Entrez Gene

9475

Links to all GeneRIF Items

9475

Links to iHOP

9475

Sequence Information

Nucleotide Sequence

>9475 : length: 4167
atgagccggcccccgccgacggggaaaatgcccggcgcccccgagaccgcgccgggggac
ggggcaggcgcgagccgccagaggaagctggaggcgctgatccgagaccctcgctccccc
atcaacgtggagagcttgctggatggcttaaattccttggtccttgatttagattttcct
gctttgaggaaaaacaagaacatagataatttcttaaatagatatgagaaaattgtgaaa
aaaatcagaggtctacagatgaaggcagaagactatgatgttgtaaaagttattggaaga
ggtgcttttggtgaagtgcagttggttcgtcacaaggcatcgcagaaggtttatgctatg
aagcttcttagtaagtttgaaatgataaaaagatcagattctgcctttttttgggaagaa
agagatattatggcctttgccaatagcccctgggtggttcagcttttttatgcctttcaa
gatgataggtatctgtacatggtaatggagtacatgcctggtggagaccttgtaaacctt
atgagtaattatgatgtgcctgaaaaatgggccaaattttacactgctgaagttgttctt
gctctggatgcaatacactccatgggtttaatacacagagatgtgaagcctgacaacatg
ctcttggataaacatggacatctaaaattagcagattttggcacgtgtatgaagatggat
gaaacaggcatggtacattgtgatacagcagttggaacaccggattatatatcacctgag
gttctgaaatcacaagggggtgatggtttctatgggcgagaatgtgattggtggtctgta
ggtgttttcctttatgagatgctagtgggggatactccattttatgcggattcacttgta
ggaacatatagcaaaattatggatcataagaattcactgtgtttccctgaagatgcagaa
atttccaaacatgcaaagaatctcatctgtgctttcttaacagatagggaggtacgactt
gggagaaatggggtggaagaaatcagacagcatcctttctttaagaatgatcagtggcat
tgggataacataagagaaacggcagctcctgtagtacctgaactcagcagtgacatagac
agcagcaatttcgatgacattgaagatgacaaaggagatgtagaaaccttcccaattcct
aaagcttttgttggaaatcagctgcctttcatcggatttacctactatagagaaaattta
ttattaagtgactctccatcttgtagagaaactgattccatacaatcaaggaaaaatgaa
gaaagtcaagagattcagaaaaaactgtatacattagaagaacatcttagcaatgagatg
caagccaaagaggaactggaacagaagtgcaaatctgttaatactcgcctagaaaaaaca
gcaaaggagctagaagaggagattaccttacggaaaagtgtggaatcagcattaagacag
ttagaaagagaaaaggcgcttcttcagcacaaaaatgcagaatatcagaggaaagctgat
catgaagcagacaaaaaacgaaatttggaaaatgatgttaacagcttaaaagatcaactt
gaagatttgaaaaaaagaaatcaaaactctcaaatatccactgagaaagtgaatcaactc
cagagacaactggatgaaaccaatgctttactgcgaacagagtctgatactgcagcccgg
ttaaggaaaacccaggcagaaagttcaaaacagattcagcagctggaatctaacaataga
gatctacaagataaaaactgcctgctggagactgccaagttaaaacttgaaaaggaattt
atcaatcttcagtcagctctagaatctgaaaggagggatcgaacccatggatcagagata
attaatgatttacaaggtagaatatgtggcctagaagaagatttaaagaacggcaaaatc
ttactagcgaaagtagaactggagaagagacaacttcaggagagatttactgatttggaa
aaggaaaaaagcaacatggaaatagatatgacataccaactaaaagttatacagcagagc
ctagaacaagaagaagctgaacataaggccacaaaggcacgactagcagataaaaataag
atctatgagtccatcgaagaagccaaatcagaagccatgaaagaaatggagaagaagctc
ttggaggaaagaactttaaaacagaaagtggagaacctattgctagaagctgagaaaaga
tgttctctattagactgtgacctcaaacagtcacagcagaaaataaatgagctccttaaa
cagaaagatgtgctaaatgaggatgttagaaacctgacattaaaaatagagcaagaaact
cagaagcgctgccttacacaaaatgacctgaagatgcaaacacaacaggttaacacacta
aaaatgtcagaaaagcagttaaagcaagaaaataaccatctcatggaaatgaaaatgaac
ttggaaaaacaaaatgctgaacttcgaaaagaacgtcaggatgcagatgggcaaatgaaa
gagctccaggatcagctcgaagcagaacagtatttctcaaccctttataaaacacaagtt
agggagcttaaagaagaatgtgaagaaaagaccaaacttggtaaagaattgcagcagaag
aaacaggaattacaggatgaacgggactctttggctgcccaactggagatcaccttgacc
aaagcagattctgagcaactggctcgttcaattgctgaagaacaatattctgatttggaa
aaagagaagatcatgaaagagctggagatcaaagagatgatggctagacacaaacaggaa
cttacggaaaaagatgctacaattgcttctcttgaggaaactaataggacactaactagt
gatgttgccaatcttgcaaatgagaaagaagaattaaataacaaattgaaagatgttcaa
gagcaactgtcaagattgaaagatgaagaaataagcgcagcagctattaaagcacagttt
gagaagcagctattaacagaaagaacactcaaaactcaagctgtgaataagttggctgag
atcatgaatcgaaaagaacctgtcaagcgtggtaatgacacagatgtgcggagaaaagag
aaggagaatagaaagctacatatggagcttaaatctgaacgtgagaaattgacccagcag
atgatcaagtatcagaaagaactgaatgaaatgcaggcacaaatagctgaagagagccag
attcgaattgaactgcagatgacattggacagtaaagacagtgacattgagcagctgcgg
tcacaactccaagccttgcatattggtctggatagttccagtataggcagtggaccaggg
gatgctgaggcagatgatgggtttccagaatcaagattagaaggatggctttcattgcct
gtacgaaacaacactaagaaatttggatgggttaaaaagtatgtgattgtaagcagtaag
aagattcttttctatgacagtgaacaagataaagaacaatccaatccttacatggtttta
gatatagacaagttatttcatgtccgaccagttacacagacagatgtgtatagagcagat
gctaaagaaattccaaggatattccagattctgtatgccaatgaaggagaaagtaagaag
gaacaagaatttccagtggagccagttggagaaaaatctaattatatttgccacaaggga
catgagtttattcctactctttatcatttcccaaccaactgtgaggcttgtatgaagccc
ctgtggcacatgtttaagcctcctcctgctttggagtgccgccgttgccatattaagtgt
cataaagatcatatggacaaaaaggaggagattatagcaccttgcaaagtatattatgat
atttcaacggcaaagaatctgttattactagcaaattctacagaagagcagcagaagtgg
gttagtcggttggtgaaaaagatacctaaaaagcccccagctccagacccttttgcccga
tcatctcctagaacttcaatgaagatacagcaaaaccagtctattagacggccaagtcga
cagcttgccccaaacaaacctagctaa

Protein Sequence

>9475 : length: 1388
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWH
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKT
AKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKI
LLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
DAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS



')