Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

94234

Name

FOXQ1

Synonym

HFH1;forkhead box Q1;FOXQ1;forkhead box Q1

Definition

HFH-1|HNF-3/forkhead-like protein 1|forkhead box protein Q1|hepatocyte nuclear factor 3 forkhead homolog 1|winged helix/forkhead transcription factor

Position

6p25

Gene Type

protein-coding

External Links

Links to Entrez Gene

94234

Links to all GeneRIF Items

94234

Links to iHOP

94234

Sequence Information

Nucleotide Sequence

>94234 : length: 1212
atgaagttggaggtgttcgtccctcgcgcggcccacggggacaagcagggcagtgacctg
gagggcgcgggcggcagcgacgcgccgtccccgctgtcggcggcgggagacgactccctg
ggctcagatggggactgcgcggccaacagcccggccgcgggcggcggcgccagagatacg
cagggcgacggcgaacagagtgcgggaggcgggccgggcgcggaggaggcgatcccggca
gcagctgctgcagcggtggtggcggagggcgcggaggccggggcggcggggccaggcgcg
ggcggcgcggggagcggcgagggtgcacgcagcaagccatatacgcggcggcccaagccc
ccctactcgtacatcgcgctcatcgccatggccatccgcgactcggcgggcgggcgcttg
acgctggcggagatcaacgagtacctcatgggcaagttcccctttttccgcggcagctac
acgggctggcgcaactccgtgcgccacaacctttcgctcaacgactgcttcgtcaaggtg
ctgcgcgacccctcgcggccctggggcaaggacaactactggatgctcaaccccaacagc
gagtacaccttcgccgacggggtcttccgccgccgccgcaagcgcctcagccaccgcgcg
ccggtccccgcgcccgggctgcggcccgaggaggccccgggcctccccgccgccccgccg
cccgcgcccgccgccccggcctcgccccgcatgcgctcgcccgcccgccaggaggagcgc
gccagccccgcgggcaagttctccagctccttcgccatcgacagcatcctgcgcaagccc
ttccgcagccgccgcctcagggacacggcccccgggacgacgcttcagtggggcgccgcg
ccctgcccgccgctgcccgcgttccccgcgctcctccccgcggcgccctgcagggccctg
ctgccgctctgcgcgtacggcgcgggcgagccggcgcggctgggcgcgcgcgaggccgag
gtgccaccgaccgcgccgcccctcctgcttgcacctctcccggcggcggcccccgccaag
ccactccgaggcccggcggccggcggcgcgcacctgtactgccccctgcggctgcccgca
gccctgcaggcggcctcagtccgccgccctggcccgcacctgccgtacccggtggagacg
ctcctagcctga

Protein Sequence

>94234 : length: 403
MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDT
QGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKP
PYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKV
LRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVPAPGLRPEEAPGLPAAPP
PAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKPFRSRRLRDTAPGTTLQWGAA
PCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLLAPLPAAAPAK
PLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA



')