Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9372

Name

ZFYVE9

Synonym

MADHIP|NSP|SARA|SMADIP;zinc finger, FYVE domain containing 9;ZFYVE9;zinc finger, FYVE domain containing 9

Definition

MAD homolog interacting protein|MAD, mothers against decapentaplegic homolog interacting protein, receptor activation anchor|MADH-interacting protein|hSARA|mothers against decapentaplegic homolog interacting protein|mothers against decapentaplegic homolog

Position

1p32.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

Signaling by TGF beta;Reactome;REACT:6844

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

External Links

Links to Entrez Gene

9372

Links to all GeneRIF Items

9372

Links to iHOP

9372

Sequence Information

Nucleotide Sequence

>9372 : length: 4278
atggagaattacttccaagcagaagcttacaacctggacaaggtgttagatgaatttgaa
caaaacgaagatgaaacagtttcttctactttattggatacaaagtggaataagattcta
gatcccccttctcaccggctgtcatttaaccctactttggccagtgtgaatgaatctgca
gtttctaatgagtcacaaccacaactgaaagtcttctccctggctcattcagctcccctg
accacagaggaagaggatcactgtgctaatggacaggactgtaatctaaatccagagatt
gccacaatgtggattgatgaaaatgctgttgcagaagaccagttaattaagagaaactat
agttgggatgatcaatgcagtgctgttgaagtgggagagaagaaatgtggaaacctggct
tgtctgccagatgagaagaatgttcttgttgtagccgtcatgcataactgtgataaaagg
acattacaaaacgatttacaggattgtaataattataatagtcaatcccttatggatgct
tttagctgttcactggataatgaaaacagacaaactgatcaatttagttttagtataaat
gagtccactgaaaaagatatgaattcagagaaacaaatggatccattgaatagaccgaaa
acagaggggagatctgttaaccatctgtgtcctacttcatctgatagtctagccagtgtc
tgttccccttcacaattaaaggatgacggaagtataggtagagacccctccatgtctgcg
attacaagtttaacggttgattcagtaatctcatcccagggaacagatggatgtcctgct
gttaaaaagcaagagaactatataccagatgaggacctcactggcaaaatcagctctcct
aggacagatctagggagtccaaattccttttcccacatgagtgaggggattttgatgaaa
aaagagccagcagaggagagcaccactgaagaatccctccggtctggtttacctttgctt
ctcaaaccagacatgcctaatgggtctggaaggaataatgactgtgaacggtgttcagat
tgccttgtgcctaatgaagttagggctgatgaaaatgaaggttatgaacatgaagaaact
cttggcactacagaattccttaatatgacagagcatttctctgaatctcaggacatgact
aattggaagttgactaaactaaatgagatgaatgatagccaagtaaacgaagaaaaggaa
aagtttctacagattagtcagcctgaggacactaatggtgatagtggaggacagtgtgtt
ggattggcagatgcaggtctagatttaaaaggaacttgcattagtgaaagtgaagaatgt
gatttctccactgttatagacacaccagcagcaaattatctatctaatggttgtgattcc
tatggaatgcaagacccaggtgtttcttttgttccaaagactttaccctccaaagaagat
tcagtaacagaagaaaaagaaatagaggaaagcaagtcagaatgctactcaaatatttat
gaacagagaggaaatgaggccacagaagggagtggactacttttaaacagcactggtgac
ctaatgaagaaaaattatttacataatttctgtagtcaagttccatcagtgcttgggcaa
tcttcccccaaggtagtagcaagcctgccatctatcagtgttccttttggtggtgcaaga
cccaagcaaccttctaatcttaaacttcaaattccaaagccattatcagaccatttacaa
aatgactttcctgcaaacagtggaaataatactaaaaataaaaatgatattcttgggaaa
gcaaaattaggggaaaactcagcaaccaatgtatgcagtccatctttgggaaacatctct
aatgtcgatacaaatggggaacatttagaaagttatgaggctgagatctccactagacca
tgccttgcattagctccagatagcccagataatgatctcagagctggtcagtttggaatt
tctgccagaaagccattcaccactctgggtgaggtggctccagtatgggtaccggattct
caggctccaaattgcatgaaatgtgaagccaggtttacattcaccaaaaggaggcatcac
tgcagagcatgtgggaaggttttctgtgcttcctgctgtagcctgaaatgtaaactgtta
tacatggacagaaaggaagctagagtgtgtgtaatctgccattcagtgctaatgaatgct
caagcctgggagaacatgatgagtgcctcaagccagagccctaaccctaacaatcctgct
gaatactgttctactatccctcccttgcagcaagctcaggcctcaggagctctgagctct
ccacctcccactgtgatggtacctgtgggagttttaaagcaccctggagcagaagtggct
cagcccagagagcagaggcgagtttggtttgctgatgggatcttgcccaatggagaagtt
gctgatgcagccaaattaacaatgaatggaacttcctctgcaggaaccctggctgtgtca
cacgacccagtcaagccagtaactaccagtcctctaccagcagagacggatatttgtcta
ttctctgggagtataactcaggttggaagtcctgttggaagtgcaatgaatcttattcct
gaagatggccttcctcccattctcatctccactggtgtaaaaggagactatgctgtggaa
gagaaaccatcacagatttcagtaatgcagcagttggaggatggtggccctgacccactt
gtatttgttttaaatgcaaatttgttgtcaatggttaaaattgtaaattatgtgaacagg
aagtgctggtgtttcacaaccaagggaatgcatgcagtgggtcagtctgagatagtcatt
cttctacagtgtttaccggatgaaaagtgtttgccaaaggatatctttaatcactttgtg
cagctttatcgggatgctctggcagggaatgtggtgagcaacttgggacattccttcttc
agtcaaagtttccttggcagtaaagaacatggtggattcttatatgtgacatctacctac
cagtcactgcaagacctagtactcccaaccccaccttacttgtttgggattcttatccag
aaatgggaaactccttgggctaaagtatttcctatccgtctgatgttgagacttggagct
gaatatcgactttatccatgcccactattcagtgtcagatttcggaagccattgtttgga
gagacggggcataccatcatgaatcttcttgcagacttcagaaattaccagtataccttg
ccagtagttcaaggtttggtggttgatatggaagttcggaaaactagcatcaaaattccc
agcaacagatacaatgagatgatgaaagccatgaacaagtccaatgagcatgtcctggca
ggaggtgcctgcttcaatgaaaaggcagactctcatcttgtgtgtgtacagaatgatgat
ggaaactatcagacccaggctatcagtattcacaatcagcccagaaaagtgactggtgcc
agtttctttgtgttcagtggcgctctgaaatcctcttctggataccttgccaagtccagt
attgtggaagatggtgttatggtccagattactgcagagaacatggattccttgaggcag
gcactgcgagagatgaaggacttcaccatcacctgtgggaaggcggacgcggaggaaccc
caggagcacatccacatccagtgggtggatgatgacaagaacgttagcaagggtgtcgta
agtcctatagatgggaagtccatggagactataacaaatgtgaagatattccatggatca
gaatataaagcaaatggaaaagtaatcagatggacagaggtgtttttcctagaaaacgat
gaccagcacaattgcctcagtgatcctgcagatcacagtagattgactgagcatgttgcc
aaagctttttgccttgctctctgtcctcacctgaaacttctgaaggaagatggaatgacc
aaactgggactacgtgtgacacttgactcagatcaggttggctatcaagcagggagcaat
ggccagccccttccctcgcagtacatgaatgatctggacagcgccttggtgccggtgatc
catggaggggcctgccagcttagtgagggccccgttgtcatggaactcatcttttatatt
ctggaaaacatcgtataa

Protein Sequence

>9372 : length: 1425
MENYFQAEAYNLDKVLDEFEQNEDETVSSTLLDTKWNKILDPPSHRLSFNPTLASVNESA
VSNESQPQLKVFSLAHSAPLTTEEEDHCANGQDCNLNPEIATMWIDENAVAEDQLIKRNY
SWDDQCSAVEVGEKKCGNLACLPDEKNVLVVAVMHNCDKRTLQNDLQDCNNYNSQSLMDA
FSCSLDNENRQTDQFSFSINESTEKDMNSEKQMDPLNRPKTEGRSVNHLCPTSSDSLASV
CSPSQLKDDGSIGRDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSP
RTDLGSPNSFSHMSEGILMKKEPAEESTTEESLRSGLPLLLKPDMPNGSGRNNDCERCSD
CLVPNEVRADENEGYEHEETLGTTEFLNMTEHFSESQDMTNWKLTKLNEMNDSQVNEEKE
KFLQISQPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDS
YGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSNIYEQRGNEATEGSGLLLNSTGD
LMKKNYLHNFCSQVPSVLGQSSPKVVASLPSISVPFGGARPKQPSNLKLQIPKPLSDHLQ
NDFPANSGNNTKNKNDILGKAKLGENSATNVCSPSLGNISNVDTNGEHLESYEAEISTRP
CLALAPDSPDNDLRAGQFGISARKPFTTLGEVAPVWVPDSQAPNCMKCEARFTFTKRRHH
CRACGKVFCASCCSLKCKLLYMDRKEARVCVICHSVLMNAQAWENMMSASSQSPNPNNPA
EYCSTIPPLQQAQASGALSSPPPTVMVPVGVLKHPGAEVAQPREQRRVWFADGILPNGEV
ADAAKLTMNGTSSAGTLAVSHDPVKPVTTSPLPAETDICLFSGSITQVGSPVGSAMNLIP
EDGLPPILISTGVKGDYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKIVNYVNR
KCWCFTTKGMHAVGQSEIVILLQCLPDEKCLPKDIFNHFVQLYRDALAGNVVSNLGHSFF
SQSFLGSKEHGGFLYVTSTYQSLQDLVLPTPPYLFGILIQKWETPWAKVFPIRLMLRLGA
EYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTLPVVQGLVVDMEVRKTSIKIP
SNRYNEMMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQPRKVTGA
SFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKADAEEP
QEHIHIQWVDDDKNVSKGVVSPIDGKSMETITNVKIFHGSEYKANGKVIRWTEVFFLEND
DQHNCLSDPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVGYQAGSN
GQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIV



')