Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9365

Name

KL

Synonym

-;klotho;KL;klotho

Definition

-

Position

13q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Signaling by FGFR;Reactome;REACT:9470

Disease

bone density and spondylosis;GAD

Disease

angina, vasospastic atherosclerosis, coronary;GAD

Disease

Coronary artery disease, susceptibility to;OMIM

Disease

cholesterol, HDL;GAD

Disease

blood pressure, arterial body mass glucose insulin lipids;GAD

Disease

spondylosis, lumbar;GAD

Disease

AGING;GAD

Disease

longevity;GAD

Disease

Cardiomyopathies;GAD

Disease

Coronary Stenosis;GAD

Disease

stroke, ischemic;GAD

Disease

atherosclerosis, coronary;GAD

Disease

Aseptic necrosis of bone;FunDO

Disease

osteoarthritis;GAD

Disease

METABOLIC;GAD

Disease

Calcinosis;GAD

Disease

Tumoral calcinosis, hyperphosphatemic;OMIM

Disease

Stroke;FunDO

Disease

aging;GAD

Disease

bone density;GAD

Disease

age-related skeletal disorders;GAD

Disease

Diabetes mellitus;FunDO

Disease

CHEMDEPENDENCY;GAD

Disease

bone density osteoarthritis osteoporosis;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Stroke;GAD

Disease

Kidney failure;FunDO

Disease

NEUROLOGICAL;GAD

Disease

blood pressure, arterial;GAD

Disease

smoking cessation;GAD

Disease

memory impairment;GAD

Disease

Spondylarthropathies;FunDO

Disease

Arthritis;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

9365

Links to all GeneRIF Items

9365

Links to iHOP

9365

Sequence Information

Nucleotide Sequence

>9365 : length: 3039
atgcccgccagcgccccgccgcgccgcccgcggccgccgccgccgtcgctgtcgctgctg
ctggtgctgctgggcctgggcggccgccgcctgcgtgcggagccgggcgacggcgcgcag
acctgggcccgtttctcgcggcctcctgcccccgaggccgcgggcctcttccagggcacc
ttccccgacggcttcctctgggccgtgggcagcgccgcctaccagaccgagggcggctgg
cagcagcacggcaagggtgcgtccatctgggatacgttcacccaccaccccctggcaccc
ccgggagactcccggaacgccagtctgccgttgggcgccccgtcgccgctgcagcccgcc
accggggacgtagccagcgacagctacaacaacgtcttccgcgacacggaggcgctgcgc
gagctcggggtcactcactaccgcttctccatctcgtgggcgcgagtgctccccaatggc
agcgcgggcgtccccaaccgcgaggggctgcgctactaccggcgcctgctggagcggctg
cgggagctgggcgtgcagcccgtggtcaccctgtaccactgggacctgccccagcgcctg
caggacgcctacggcggctgggccaaccgcgccctggccgaccacttcagggattacgcg
gagctctgcttccgccacttcggcggtcaggtcaagtactggatcaccatcgacaacccc
tacgtggtggcctggcacggctacgccaccgggcgcctggcccccggcatccggggcagc
ccgcggctcgggtacctggtggcgcacaacctcctcctggctcatgccaaagtctggcat
ctctacaatacttctttccgtcccactcagggaggtcaggtgtccattgccctaagctct
cactggatcaatcctcgaagaatgaccgaccacagcatcaaagaatgtcaaaaatctctg
gactttgtactaggttggtttgccaaacccgtatttattgatggtgactatcccgagagc
atgaagaataacctttcatctattctgcctgattttactgaatctgagaaaaagttcatc
aaaggaactgctgacttttttgctctttgctttggacccaccttgagttttcaacttttg
gaccctcacatgaagttccgccaattggaatctcccaacctgaggcaactgctttcctgg
attgaccttgaatttaaccatcctcaaatatttattgtggaaaatggctggtttgtctca
gggaccaccaagagagatgatgccaaatatatgtattacctcaaaaagttcatcatggaa
accttaaaagccatcaagctggatggggtggatgtcatcgggtataccgcatggtccctc
atggatggtttcgagtggcacagaggttacagcatcaggcgtggactcttctatgttgac
tttctaagccaggacaagatgttgttgccaaagtcttcagccttgttctaccaaaagctg
atagagaaaaatggcttccctcctttacctgaaaatcagcccctagaagggacatttccc
tgtgactttgcttggggagttgttgacaactacattcaagtagataccactctgtctcag
tttaccgacctgaatgtttacctgtgggatgtccaccacagtaaaaggcttattaaagtg
gatggggttgtgaccaagaagaggaaatcctactgtgttgactttgctgccatccagccc
cagatcgctttactccaggaaatgcacgttacacattttcgcttctccctggactgggcc
ctgattctccctctgggtaaccagtcccaggtgaaccacaccatcctgcagtactatcgc
tgcatggccagcgagcttgtccgtgtcaacatcaccccagtggtggccctgtggcagcct
atggccccgaaccaaggactgccgcgcctcctggccaggcagggcgcctgggagaacccc
tacactgccctggcctttgcagagtatgcccgactgtgctttcaagagctcggccatcac
gtcaagctttggataacgatgaatgagccgtatacaaggaatatgacatacagtgctggc
cacaaccttctgaaggcccatgccctggcttggcatgtgtacaatgaaaagtttaggcat
gctcagaatgggaaaatatccatagccttgcaggctgattggatagaacctgcctgccct
ttctcccaaaaggacaaagaggtggctgagagagttttggaatttgacattggctggctg
gctgagcccattttcggctctggagattatccatgggtgatgagggactggctgaaccaa
agaaacaattttcttcttccttatttcactgaagatgaaaaaaagctaatccagggtacc
tttgactttttggctttaagccattataccaccatccttgtagactcagaaaaagaagat
ccaataaaatacaatgattacctagaagtgcaagaaatgaccgacatcacgtggctcaac
tcccccagtcaggtggcggtagtgccctgggggttgcgcaaagtgctgaactggctgaag
ttcaagtacggagacctccccatgtacataatatccaatggaatcgatgacgggctgcat
gctgaggacgaccagctgagggtgtattatatgcagaattacataaacgaagctctcaaa
gcccacatactggatggtatcaatctttgcggatactttgcttattcgtttaacgaccgc
acagctccgaggtttggcctctatcgttatgctgcagatcagtttgagcccaaggcatcc
atgaaacattacaggaaaattattgacagcaatggtttcccgggcccagaaactctggaa
agattttgtccagaagaattcaccgtgtgtactgagtgcagtttttttcacacccgaaag
tctttactggctttcatagcttttctattttttgcttctattatttctctctcccttata
ttttactactcgaagaaaggcagaagaagttacaaatag

Protein Sequence

>9365 : length: 1012
MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQGT
FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPA
TGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERL
RELGVQPVVTLYHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNP
YVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEKKFI
KGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHPQIFIVENGWFVS
GTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVD
FLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQ
FTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENP
YTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRH
AQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWLNQ
RNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLN
SPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPETLE
RFCPEEFTVCTECSFFHTRKSLLAFIAFLFFASIISLSLIFYYSKKGRRSYK



')