Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9314

Name

KLF4

Synonym

EZF|GKLF;Kruppel-like factor 4 (gut);KLF4;Kruppel-like factor 4 (gut)

Definition

Krueppel-like factor 4|endothelial Kruppel-like zinc finger protein|epithelial zinc finger protein EZF|gut-enriched krueppel-like factor

Position

9q31

Gene Type

protein-coding

Pathways and Diseases

Pathway

Synthesis, Secretion, and Deacylation of Ghrelin;PID Reactome;500141

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Disease

Alimentary system disease;FunDO

Disease

Gastrointestinal tumor;FunDO

Disease

Gastrointestinal cancer;FunDO

Disease

Breast cancer;FunDO

External Links

Links to Entrez Gene

9314

Links to all GeneRIF Items

9314

Links to iHOP

9314

Sequence Information

Nucleotide Sequence

>9314 : length: 1440
atgaggcagccacctggcgagtctgacatggctgtcagcgacgcgctgctcccatctttc
tccacgttcgcgtctggcccggcgggaagggagaagacactgcgtcaagcaggtgccccg
aataaccgctggcgggaggagctctcccacatgaagcgacttcccccagtgcttcccggc
cgcccctatgacctggcggcggcgaccgtggccacagacctggagagcggcggagccggt
gcggcttgcggcggtagcaacctggcgcccctacctcggagagagaccgaggagttcaac
gatctcctggacctggactttattctctccaattcgctgacccatcctccggagtcagtg
gccgccaccgtgtcctcgtcagcgtcagcctcctcttcgtcgtcgccgtcgagcagcggc
cctgccagcgcgccctccacctgcagcttcacctatccgatccgggccgggaacgacccg
ggcgtggcgccgggcggcacgggcggaggcctcctctatggcagggagtccgctccccct
ccgacggctcccttcaacctggcggacatcaacgacgtgagcccctcgggcggcttcgtg
gccgagctcctgcggccagaattggacccggtgtacattccgccgcagcagccgcagccg
ccaggtggcgggctgatgggcaagttcgtgctgaaggcgtcgctgagcgcccctggcagc
gagtacggcagcccgtcggtcatcagcgtcagcaaaggcagccctgacggcagccacccg
gtggtggtggcgccctacaacggcgggccgccgcgcacgtgccccaagatcaagcaggag
gcggtctcttcgtgcacccacttgggcgctggaccccctctcagcaatggccaccggccg
gctgcacacgacttccccctggggcggcagctccccagcaggactaccccgaccctgggt
cttgaggaagtgctgagcagcagggactgtcaccctgccctgccgcttcctcccggcttc
catccccacccggggcccaattacccatccttcctgcccgatcagatgcagccgcaagtc
ccgccgctccattaccaagagctcatgccacccggttcctgcatgccagaggagcccaag
ccaaagaggggaagacgatcgtggccccggaaaaggaccgccacccacacttgtgattac
gcgggctgcggcaaaacctacacaaagagttcccatctcaaggcacacctgcgaacccac
acaggtgagaaaccttaccactgtgactgggacggctgtggatggaaattcgcccgctca
gatgaactgaccaggcactaccgtaaacacacggggcaccgcccgttccagtgccaaaaa
tgcgaccgagcattttccaggtcggaccacctcgccttacacatgaagaggcatttttaa

Protein Sequence

>9314 : length: 479
MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPG
RPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESV
AATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPP
PTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGS
EYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP
AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQV
PPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTH
TGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF



')