Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

92140

Name

MTDH

Synonym

3D3|AEG-1|AEG1|LYRIC|LYRIC/3D3;metadherin;MTDH;metadherin

Definition

3D3/LYRIC|astrocyte elevated gene-1 protein|lysine-rich CEACAM1 co-isolated protein|metastasis adhesion protein|protein LYRIC

Position

8q22.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Migraine;NHGRI

External Links

Links to Entrez Gene

92140

Links to all GeneRIF Items

92140

Links to iHOP

92140

Sequence Information

Nucleotide Sequence

>92140 : length: 1749
atggctgcacggagctggcaggacgagctggcccagcaggccgaggagggctcggcccgg
ctgcgggaaatgctctcggtcggcctaggctttctgcgcaccgagctgggcctcgacctg
gggctggagccgaaacggtaccccggctgggtgatcctggtgggcactggcgcgctcggg
ctgctgctgctgtttctgctgggctacggctgggccgcggcttgcgccggcgcccgcaaa
aagcggaggagcccgccccgcaagcgggaggaggcggcggccgtgccggccgcggccccc
gacgacctggccttgctgaagaatctccggagcgaggaacagaagaagaagaaccggaag
aaactgtccgagaagcccaaaccaaatgggcggactgttgaagtggctgagggtgaagct
gttcgaacacctcaaagtgtaacagcaaagcagccaccagagattgacaagaaaaatgaa
aagtcaaagaaaaataagaagaaatcaaagtcagatgctaaagcagtgcaaaacagttca
cgccatgatggaaaggaagttgatgaaggagcctgggaaactaaaattagtcacagagag
aaacgacagcagcgtaaacgtgataaggtgctgactgattctggttcattggattcaact
atccctgggatagaaaataccatcacagttaccaccgagcaacttacaaccgcatcattt
cctgttggttccaagaagaataaaggtgattctcatctaaatgttcaagttagcaacttt
aaatctggaaaaggagattctacacttcaggtttcttcaggattgaatgaaaacctcact
gtcaatggaggaggctggaatgaaaagtctgtaaaactctcctcacagatcagtgcaggt
gaggagaagtggaactccgtttcacctgcttctgcaggaaagaggaaaactgagccatct
gcctggagtcaagacactggagatgctaatacaaatggaaaagactggggaaggagttgg
agtgaccgttcaatattttctggcattgggtctactgctgagccagtttctcagtctacc
acttctgattatcagtgggatgttagccgtaatcaaccctatatcgatgatgaatggtct
gggttaaatggtctgtcttctgctgatcccaactctgattggaatgcaccagcagaagag
tggggcaattgggtagacgaagaaagagcttcacttctaaagtcccaggaaccaattcct
gatgatcaaaaggtctcagatgatgataaagaaaagggagagggagctcttccaactggg
aaatccaaaaagaaaaaaaagaaaaagaagaagcaaggtgaagataactctactgcacag
gacacagaagaattagaaaaagagattagagaagaccttccagtgaatacctctaaaacc
cgtccaaaacaggaaaaagctttttccttgaagaccataagcactagtgatccagccgaa
gtactcgtcaaaaatagccagcctatcaagactcttccacctgctacttctaccgagcca
tctgtaatcttatcaaaaagtgattctgacaagagctcttcccaagtgccgccaatacta
caagagacagataaatccaagtcaaataccaagcaaaatagtgtgcctccttcacagacc
aagtctgaaactagctgggaatctcccaaacaaataaaaaagaagaaaaaagccagacga
gaaacgtga

Protein Sequence

>92140 : length: 582
MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALG
LLLLFLLGYGWAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRK
KLSEKPKPNGRTVEVAEGEAVRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSS
RHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASF
PVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAG
EEKWNSVSPASAGKRKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQST
TSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIP
DDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKT
RPKQEKAFSLKTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPIL
QETDKSKSNTKQNSVPPSQTKSETSWESPKQIKKKKKARRET



')