Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

91862

Name

MARVELD3

Synonym

MARVD3|MRVLDC3;MARVEL domain containing 3;MARVELD3;MARVEL domain containing 3

Definition

MARVEL (membrane-associating) domain containing 3|MARVEL domain-containing protein 3

Position

16q22.2

Gene Type

protein-coding

External Links

Links to Entrez Gene

91862

Links to all GeneRIF Items

91862

Links to iHOP

91862

Sequence Information

Nucleotide Sequence

>91862 : length: 1233
atggaagatccgtcgggggctcgcgagccccgggcccggccgagagagcgggacccggga
cggcgcccccacccagaccaaggccgcacccacgatcgaccgcgggaccgacccggggac
ccgcgcaggaagcgaagcagcgacgggaaccggcgaagggacggggaccgggacccggag
agagaccaggagagggacgggaaccgcgaccggaaccgggaccgggagagggagagagag
agggaaagagacccggaccgaggcccccgccgggacacacacagggacgcgggccctcgc
gcaggtgaacacggagtttgggaaaaaccgcgccaaagccggacgcgggacggagcccgg
ggactgacctgggacgcagccgcgcctcctgggcccgcgccctgggaagccccggagccg
ccgcagccgcagaggaagggagaccccgggcgccgcagacccgaaagtgaacccccttcg
gagagatatctgccctcgacccccaggcctggacgagaggaggtggaatattaccagtca
gaggcggaaggactcctggaatgccacaaatgcaaatacttgtgcactgggagaggtgtg
gtgcagatagtggaggtggtcttgaatgggatggttctcatatgcatcgtggcctcctac
tttgtccttgccggattcagtgccagcttttccagcggcggtggctttgggaacaactac
tactcaccgttcgagggcactgagctagagcaggttcggcagctggaccagcagtacacg
atcctccgctcgcccctgatatacggtggcgtggctgtttctctgggtctgggggtcctc
accatgggtgttttactccaaggagccaagagtcgaacaatgttgtcagggaagtggctc
ctcacggaggccgccttcagcctcctagcggcagtgggctactgcacaggcattggtgtt
tacctccacgtggctctgcagatcaatagcaccgacacttgcaaaacaagagagaggctc
tatgcccgcaagggtctcacctggatggactgccagctggcaggcaccgacggagcagca
gccacctttgcttgtcttctcgtgatcatgtacggcgccagcgtggtgctggccctgcgt
agctaccgagaacagaagcgctacaaaggcagccgagaacagcccggaagttacagtgat
gcaccggaatatctgtggtctggaactctttga

Protein Sequence

>91862 : length: 410
MEDPSGAREPRARPRERDPGRRPHPDQGRTHDRPRDRPGDPRRKRSSDGNRRRDGDRDPE
RDQERDGNRDRNRDRERERERERDPDRGPRRDTHRDAGPRAGEHGVWEKPRQSRTRDGAR
GLTWDAAAPPGPAPWEAPEPPQPQRKGDPGRRRPESEPPSERYLPSTPRPGREEVEYYQS
EAEGLLECHKCKYLCTGRGVVQIVEVVLNGMVLICIVASYFVLAGFSASFSSGGGFGNNY
YSPFEGTELEQVRQLDQQYTILRSPLIYGGVAVSLGLGVLTMGVLLQGAKSRTMLSGKWL
LTEAAFSLLAAVGYCTGIGVYLHVALQINSTDTCKTRERLYARKGLTWMDCQLAGTDGAA
ATFACLLVIMYGASVVLALRSYREQKRYKGSREQPGSYSDAPEYLWSGTL



')