Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9113

Name

LATS1

Synonym

WARTS|wts;LATS, large tumor suppressor, homolog 1 (Drosophila);LATS1;LATS, large tumor suppressor, homolog 1 (Drosophila)

Definition

LATS (large tumor suppressor, Drosophila) homolog 1|WARTS protein kinase|h-warts|large tumor suppressor homolog 1|serine/threonine-protein kinase LATS1

Position

6q25.1

Gene Type

protein-coding

External Links

Links to Entrez Gene

9113

Links to all GeneRIF Items

9113

Links to iHOP

9113

Sequence Information

Nucleotide Sequence

>9113 : length: 3393
atgaagaggagtgaaaagccagaaggatatagacaaatgaggcctaagacctttcctgcc
agtaactatactgtcagtagccggcaaatgttacaagaaattcgggaatcccttaggaat
ttatctaaaccatctgatgctgctaaggctgagcataacatgagtaaaatgtcaaccgaa
gatcctcgacaagtcagaaatccacccaaatttgggacgcatcataaagccttgcaggaa
attcgaaactctctgcttccatttgcaaatgaaacaaattcttctcggagtacttcagaa
gttaatccacaaatgcttcaagacttgcaagctgctggatttgatgaggatatggttata
caagctcttcagaaaactaacaacagaagtatagaagcagcaattgaattcattagtaaa
atgagttaccaagatcctcgacgagagcagatggctgcagcagctgccagacctattaat
gccagcatgaaaccagggaatgtgcagcaatcagttaaccgcaaacagagctggaaaggt
tctaaagaatccttagttcctcagaggcatggcccgccactaggagaaagtgtggcctat
cattctgagagtcccaactcacagacagatgtaggaagacctttgtctggatctggtata
tcagcatttgttcaagctcaccctagcaacggacagagagtgaaccccccaccaccacct
caagtaaggagtgttactcctccaccacctccaagaggccagactccccctccaagaggt
acaactccacctcccccttcatgggaaccaaactctcaaacaaagcgctattctggaaac
atggaatacgtaatctcccgaatctctcctgtcccacctggggcatggcaagagggctat
cctccaccacctctcaacacttcccccatgaatcctcctaatcaaggacagagaggcatt
agttctgttcctgttggcagacaaccaatcatcatgcagagttctagcaaatttaacttt
ccatcagggagacctggaatgcagaatggtactggacaaactgatttcatgatacaccaa
aatgttgtccctgctggcactgtgaatcggcagccaccacctccatatcctctgacagca
gctaatggacaaagcccttctgctttacaaacagggggatctgctgctccttcgtcatat
acaaatggaagtattcctcagtctatgatggtgccaaacagaaatagtcataacatggaa
ctatataacattagtgtacctggactgcaaacaaattggcctcagtcatcttctgctcca
gcccagtcatccccgagcagtgggcatgaaatccctacatggcaacctaacataccagtg
aggtcaaattcttttaataacccattaggaaatagagcaagtcactctgctaattctcag
ccttctgctacaacagtcactgcaattacaccagctcctattcaacagcctgtgaaaagt
atgcgtgtattaaaaccagagctacagactgctttagcacctacacacccttcttggata
ccacagccaattcaaactgttcaacccagtccttttcctgagggaaccgcttcaaatgtg
actgtgatgccacctgttgctgaagctccaaactatcaaggaccaccaccaccctaccca
aaacatctgctgcaccaaaacccatctgttcctccatacgagtcaatcagtaagcctagc
aaagaggatcagccaagcttgcccaaggaagatgagagtgaaaagagttatgaaaatgtt
gatagtggggataaagaaaagaaacagattacaacttcacctattactgttaggaaaaac
aagaaagatgaagagcgaagggaatctcgtattcaaagttattctcctcaagcatttaaa
ttctttatggagcaacatgtagaaaatgtactcaaatctcatcagcagcgtctacatcgt
aaaaaacaattagagaatgaaatgatgcgggttggattatctcaagatgcccaggatcaa
atgagaaagatgctttgccaaaaagaatctaattacatccgtcttaaaagggctaaaatg
gacaagtctatgtttgtgaagataaagacactaggaataggagcatttggtgaagtctgt
ctagcaagaaaagtagatactaaggctttgtatgcaacaaaaactcttcgaaagaaagat
gttcttcttcgaaatcaagtcgctcatgttaaggctgagagagatatcctggctgaagct
gacaatgaatgggtagttcgtctatattattcattccaagataaggacaatttatacttt
gtaatggactacattcctgggggtgatatgatgagcctattaattagaatgggcatcttt
ccagaaagtctggcacgattctacatagcagaacttacctgtgcagttgaaagtgttcat
aaaatgggttttattcatagagatattaaacctgataatattttgattgatcgtgatggt
catattaaattgactgactttggcctctgcactggcttcagatggacacacgattctaag
tactatcagagtggtgaccatccacggcaagatagcatggatttcagtaatgaatggggg
gatccctcaagctgtcgatgtggagacagactgaagccattagagcggagagctgcacgc
cagcaccagcgatgtctagcacattctttggttgggactcccaattatattgcacctgaa
gtgttgctacgaacaggatacacacagttgtgtgattggtggagtgttggtgttattctt
tttgaaatgttggtgggacaacctcctttcttggcacaaacaccattagaaacacaaatg
aaggttatcaactggcaaacatctcttcacattccaccacaagctaaactcagtcctgaa
gcttctgatcttattattaaactttgccgaggacccgaagatcgcttaggcaagaatggt
gctgatgaaataaaagctcatccattttttaaaacaattgacttctccagtgacctgaga
cagcagtctgcttcatacattcctaaaatcacacacccaacagatacatcaaattttgat
cctgttgatcctgataaattatggagtgatgataacgaggaagaaaatgtaaatgacact
ctcaatggatggtataaaaatggaaagcatcctgaacatgcattctatgaatttaccttc
cgaaggttttttgatgacaatggctacccatataattatccgaagcctattgaatatgaa
tacattaattcacaaggctcagagcagcagtcggatgaagatgatcaaaacacaggctca
gagattaaaaatcgcgatctagtatatgtttaa

Protein Sequence

>9113 : length: 1130
MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTE
DPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVI
QALQKTNNRSIEAAIEFISKMSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKG
SKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQAHPSNGQRVNPPPPP
QVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGY
PPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNGTGQTDFMIHQ
NVVPAGTVNRQPPPPYPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNME
LYNISVPGLQTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQ
PSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQTVQPSPFPEGTASNV
TVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENV
DSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHR
KKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVC
LARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYF
VMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDG
HIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAAR
QHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQM
KVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLR
QQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTF
RRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNRDLVYV



')