Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9112

Name

MTA1

Synonym

-;metastasis associated 1;MTA1;metastasis associated 1

Definition

metastasis associated gene 1 protein|metastasis-associated protein MTA1

Position

14q32.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

9112

Links to all GeneRIF Items

9112

Links to iHOP

9112

Sequence Information

Nucleotide Sequence

>9112 : length: 1293
atggccgccaacatgtacagggtcggagactacgtctactttgagaactcctccagcaac
ccatacctgatccggagaatcgaggagctcaacaagacggccaatgggaacgtggaggcc
aaagtggtgtgcttctaccggaggcgggacatctccagcaccctcatcgccctggccgac
aagcacgcaaccctgtcagtctgctataaggccggaccgggggcggacaacggcgaggaa
ggggaaatagaagaggaaatggagaatccggaaatggtggacctgcccgagaaactaaag
caccagctgcggcatcgggagctgttcctctcccggcagctggagtctctgcccgccacg
cacatcaggggcaagtgcagcgtcaccctgctcaacgagaccgagtcgctcaagtcctac
ctggagcgggaggatttcttcttctattctctagtctacgacccacagcagaagaccctg
ctggcagataaaggagagattcgagtaggaaaccggtaccaggcagacatcaccgacttg
ttaaaagaaggcgaggaggatggccgagaccagtccaggttggagacccaggtgtgggag
gcgcacaacccactcacagacaagcagatcgaccagttcctggtggtggcccgctctgtg
ggcaccttcgcacgggccctggactgcagcagctccgtccgacagcccagcctgcacatg
agcgccgcagctgcctcccgagacatcaccctgttccacgccatggatactctccacaag
aacatctacgacatctccaaggccatctcggcgctggtgccgcagggcgggcccgtgctc
tgcagggacgagatggaggagtggtctgcatcagaggccaaccttttcgaggaagccctg
gaaaaatatgggaaggatttcacggacattcagcaagattttctcccgtggaagtcgctg
accagcatcattgagtactactacatgtggaagaccaccgacagatacgtgcagcagaaa
cgcttgaaagcagctgaagctgagagcaagttaaagcaagtttatattcccaactataac
aagccaaatccgaaccaaatcagcgtcaacaacgtcaaggccggtgtggtgaacggcacg
ggggcgccgggccagagccctggggctggccgggcctgcgagagctgttacatgtcgtct
ctgcgcatcttgttggacatattggaagaaatatggtggcttgaaaatgccaacccggtt
agatggagagaggccaggaccaaaccgcagtaa

Protein Sequence

>9112 : length: 430
MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALAD
KHATLSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPAT
HIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDL
LKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHM
SAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEAL
EKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYN
KPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYMSSLRILLDILEEIWWLENANPV
RWREARTKPQ



')