Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9076

Name

CLDN1

Synonym

CLD1|ILVASC|SEMP1;claudin 1;CLDN1;claudin 1

Definition

claudin-1|senescence-associated epithelial membrane protein 1

Position

3q28-q29

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Disease

Ichthyosis, leukocyte vacuoles, alopecia, and sclerosing cholangitis;OMIM

Disease

Infection;FunDO

Disease

Hematopoietic system disease;FunDO

Disease

Cancer;FunDO

Disease

Cholestasis;FunDO

External Links

Links to Entrez Gene

9076

Links to all GeneRIF Items

9076

Links to iHOP

9076

Sequence Information

Nucleotide Sequence

>9076 : length: 636
atggccaacgcggggctgcagctgttgggcttcattctcgccttcctgggatggatcggc
gccatcgtcagcactgccctgccccagtggaggatttactcctatgccggcgacaacatc
gtgaccgcccaggccatgtacgaggggctgtggatgtcctgcgtgtcgcagagcaccggg
cagatccagtgcaaagtctttgactccttgctgaatctgagcagcacattgcaagcaacc
cgtgccttgatggtggttggcatcctcctgggagtgatagcaatctttgtggccaccgtt
ggcatgaagtgtatgaagtgcttggaagacgatgaggtgcagaagatgaggatggctgtc
attgggggtgcgatatttcttcttgcaggtctggctattttagttgccacagcatggtat
ggcaatagaatcgttcaagaattctatgaccctatgaccccagtcaatgccaggtacgaa
tttggtcaggctctcttcactggctgggctgctgcttctctctgccttctgggaggtgcc
ctactttgctgttcctgtccccgaaaaacaacctcttacccaacaccaaggccctatcca
aaacctgcaccttccagcgggaaagactacgtgtga

Protein Sequence

>9076 : length: 211
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG
QIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAV
IGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA
LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV



')