Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

9032

Name

TM4SF5

Synonym

-;transmembrane 4 L six family member 5;TM4SF5;transmembrane 4 L six family member 5

Definition

tetraspan transmembrane protein L6H|transmembrane 4 L6 family member 5|transmembrane 4 superfamily member 5

Position

17p13.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

9032

Links to all GeneRIF Items

9032

Links to iHOP

9032

Sequence Information

Nucleotide Sequence

>9032 : length: 594
atgtgtacgggaaaatgtgcccgctgtgtggggctctccctcattaccctctgcctcgtc
tgcattgtggccaacgccctcctgctggtacctaatggggagacctcctggaccaacacc
aaccatctcagcttgcaagtctggctcatgggcggcttcattggcgggggcctaatggta
ctgtgtccggggattgcagccgttcgggcagggggcaagggctgctgtggtgctgggtgc
tgtggaaaccgctgcaggatgctgcgctcggtcttctcctcggcgttcggggtgcttggt
gccatctactgcctctcggtgtctggagctgggctccgaaatggacccagatgcttaatg
aacggcgagtggggctaccacttcgaagacaccgcgggagcttacttgctcaaccgcact
ctatgggatcggtgcgaggcgccccctcgcgtggtcccctggaatgtgacgctcttctcg
ctgctggtggccgcctcctgcctggagatagtactgtgtgggatccagctggtgaacgcg
accattggtgtcttctgcggcgattgcaggaaaaaacaggacacacctcactga

Protein Sequence

>9032 : length: 197
MCTGKCARCVGLSLITLCLVCIVANALLLVPNGETSWTNTNHLSLQVWLMGGFIGGGLMV
LCPGIAAVRAGGKGCCGAGCCGNRCRMLRSVFSSAFGVLGAIYCLSVSGAGLRNGPRCLM
NGEWGYHFEDTAGAYLLNRTLWDRCEAPPRVVPWNVTLFSLLVAASCLEIVLCGIQLVNA
TIGVFCGDCRKKQDTPH



')