Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

90161

Name

HS6ST2

Synonym

-;heparan sulfate 6-O-sulfotransferase 2;HS6ST2;heparan sulfate 6-O-sulfotransferase 2

Definition

HS6ST-2|heparan-sulfate 6-O-sulfotransferase 2

Position

Xq26.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Glycosaminoglycan biosynthesis - heparan sulfate;KEGG PATHWAY;hsa00534

Pathway

heparan sulfate biosynthesis;BioCyc;PWY-6564

Pathway

heparan sulfate biosynthesis (late stages);BioCyc;PWY-6558

External Links

Links to Entrez Gene

90161

Links to all GeneRIF Items

90161

Links to iHOP

90161

Sequence Information

Nucleotide Sequence

>90161 : length: 1938
atggcactgcctgcgtgtgcagtccgggagttcgagccgccgcggcaaccggagcgagga
gcgcccgtccgcaccacctgtccccgccggcattccagagtagaggccgaattggcagcg
agccggcccgggtcggtcgccgcctcagttcgcgcgggccctcctaggggtgtgtctcac
ggattccacacccggccgctcctggacaagccccgaaaggcgtcttcttccctggcggga
gccgcgtgcgccccgcttttcgcgctgctgtcccggggccgccgcaggcggatgcacgtc
ctcaggcgacgctgggacctgggctccctctgccgggccctgctcactcggggcctggcc
gccctgggccactcgctgaagcacgtgctcggtgcgatcttctccaagattttcggcccc
atggccagcgtcgggaacatggatgagaaatccaacaagctgctgctagctttggtgatg
ctcttcctatttgccgtgatcgtcctccaatacgtgtgccccggcacagaatgccagctc
ctccgcctgcaggcgttcagctccccggtgccggacccgtaccgctcggaggatgagagc
tccgccaggttcgtgccccgctacaatttcacccgcggcgacctcctgcgcaaggtagac
ttcgacatcaagggcgatgacctgatcgtgttcctgcacatccagaagaccgggggcacc
actttcggccgccacttggtgcgtaacatccagctggagcagccgtgcgagtgccgcgtg
ggtcagaagaaatgcacttgccaccggccgggtaagcgggaaacctggctcttctccagg
ttctccacgggctggagctgcgggttgcacgccgactggaccgagctcaccagctgtgtg
ccctccgtggtggacggcaagcgcgacgccaggctgagaccgtccaggtggaggattttt
cagattctagatgcagcaagtaaggataaacggggttctccaaacactaacgcaggcgcc
aactctccgtcatccacaaagacccggaacacatctaagagtgggaagaacttccactac
atcaccatcctccgagacccagtgtcccggtacttgagtgagtggaggcatgtccagaga
ggggcaacatggaaagcatccctgcatgtctgcgatggaaggcctccaacctccgaagag
ctgcccagctgctacactggcgatgactggtctggctgccccctcaaagagtttatggac
tgtccctacaatctagccaacaaccgccaggtgcgcatgctctccgacctgaccctggta
ggctgctacaacctctctgtcatgcctgaaaagcaaagaaacaaggtccttctggaaagt
gccaagtcaaatctgaagcacatggcgttcttcggcctcactgagtttcagcggaagacc
caatatctgtttgagaaaaccttcaacatgaactttatttcgccatttacccagtataat
accactagggcctctagtgtagagatcaatgaggaaattcaaaagcgtattgagggactg
aattttctggatatggagttgtacagctatgccaaagacctttttttgcagaggtatcag
tttatgaggcagaaagagcatcaggaggccaggcgaaagcgtcaggaacaacgcaaattt
ctgaagggaaggctccttcagacccatttccagagccagggtcagggccagagccagaat
ccgaatcagaatcagagtcagaacccaaatccgaatgccaatcagaacctgactcagaat
ctgatgcagaatctgactcagagtttgagccagaaggagaaccgggaaagcccgaagcag
aactcaggcaaggagcagaatgataacaccagcaatggcaccaacgactacataggcagt
gtagagaaatggcgttaa

Protein Sequence

>90161 : length: 645
MALPACAVREFEPPRQPERGAPVRTTCPRRHSRVEAELAASRPGSVAASVRAGPPRGVSH
GFHTRPLLDKPRKASSSLAGAACAPLFALLSRGRRRRMHVLRRRWDLGSLCRALLTRGLA
ALGHSLKHVLGAIFSKIFGPMASVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQL
LRLQAFSSPVPDPYRSEDESSARFVPRYNFTRGDLLRKVDFDIKGDDLIVFLHIQKTGGT
TFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCV
PSVVDGKRDARLRPSRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGKNFHY
ITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKEFMD
CPYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKT
QYLFEKTFNMNFISPFTQYNTTRASSVEINEEIQKRIEGLNFLDMELYSYAKDLFLQRYQ
FMRQKEHQEARRKRQEQRKFLKGRLLQTHFQSQGQGQSQNPNQNQSQNPNPNANQNLTQN
LMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTNDYIGSVEKWR



')