Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

89780

Name

WNT3A

Synonym

-;wingless-type MMTV integration site family, member 3A;WNT3A;wingless-type MMTV integration site family, member 3A

Definition

protein Wnt-3a

Position

1q42

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Canonical Wnt signaling pathway;PID Curated;200064

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Wnt signaling network;PID Curated;200055

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

External Links

Links to Entrez Gene

89780

Links to all GeneRIF Items

89780

Links to iHOP

89780

Sequence Information

Nucleotide Sequence

>89780 : length: 1059
atggccccactcggatacttcttactcctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtcgctggctgttgggccacagtattcctccctgggctcgcagcccatc
ctgtgtgccagcatcccgggcctggtccccaagcagctccgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggcatcaagattggcatccaggagtgccagcaccag
ttccgcggccgccggtggaactgcaccaccgtccacgacagcctggccatcttcgggccc
gtgctggacaaagctaccagggagtcggcctttgtccacgccattgcctcagccggtgtg
gcctttgcagtgacacgctcatgtgcagaaggcacggccgccatctgtggctgcagcagc
cgccaccagggctcaccaggcaagggctggaagtggggtggctgtagcgaggacatcgag
tttggtgggatggtgtctcgggagttcgccgacgcccgggagaaccggccagatgcccgc
tcagccatgaaccgccacaacaacgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacatgctggtggtcg
caacccgacttccgcgccatcggtgacttcctcaaggacaagtacgacagcgcctcggag
atggtggtggagaagcaccgggagtcccgcggctgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgcgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaaccctgagacgggctccttcggcacgcgcgaccgcacctgcaacgtcagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcgagcg
gagcggcgccgggagaagtgccgctgcgtgttccactggtgctgctacgtcagctgccag
gagtgcacgcgcgtctacgacgtgcacacctgcaagtag

Protein Sequence

>89780 : length: 352
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK



')