Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8842

Name

PROM1

Synonym

AC133|CD133|CORD12|MCDR2|PROML1|RP41|STGD4;prominin 1;PROM1;prominin 1

Definition

antigen AC133|hProminin|hematopoietic stem cell antigen|prominin-1|prominin-like 1|prominin-like protein 1

Position

4p15.32

Gene Type

protein-coding

External Links

Links to Entrez Gene

8842

Links to all GeneRIF Items

8842

Links to iHOP

8842

Sequence Information

Nucleotide Sequence

>8842 : length: 2571
atggccctcgtactcggctccctgttgctgctggggctgtgcgggaactccttttcagga
gggcagccttcatccacagatgctcctaaggcttggaattatgaattgcctgcaacaaat
tatgagacccaagactcccataaagctggacccattggcattctctttgaactagtgcat
atctttctctatgtggtacagccgcgtgatttcccagaagatactttgagaaaattctta
cagaaggcatatgaatccaaaattgattatgacaagattgtctactatgaagcagggatt
attctatgctgtgtcctggggctgctgtttattattctgatgcctctggtggggtatttc
ttttgtatgtgtcgttgctgtaacaaatgtggtggagaaatgcaccagcgacagaaggaa
aatgggcccttcctgaggaaatgctttgcaatctccctgttggtgatttgtataataata
agcattggcatcttctatggttttgtggcaaatcaccaggtaagaacccggatcaaaagg
agtcggaaactggcagatagcaatttcaaggacttgcgaactctcttgaatgaaactcca
gagcaaatcaaatatatattggcccagtacaacactaccaaggacaaggcgttcacagat
ctgaacagtatcaattcagtgctaggaggcggaattcttgaccgactgagacccaacatc
atccctgttcttgatgagattaagtccatggcaacagcgatcaaggagaccaaagaggcg
ttggagaacatgaacagcaccttgaagagcttgcaccaacaaagtacacagcttagcagc
agtctgaccagcgtgaaaactagcctgcggtcatctctcaatgaccctctgtgcttggtg
catccatcaagtgaaacctgcaacagcatcagattgtctctaagccagctgaatagcaac
cctgaactgaggcagcttccacccgtggatgcagaacttgacaacgttaataacgttctt
aggacagatttggatggcctggtccaacagggctatcaatcccttaatgatatacctgac
agagtacaacgccaaaccacgactgtcgtagcaggtatcaaaagggtcttgaattccatt
ggttcagatatcgacaatgtaactcagcgtcttcctattcaggatatactctcagcattc
tctgtttatgttaataacactgaaagttacatccacagaaatttacctacattggaagag
tatgattcatactggtggctgggtggcctggtcatctgctctctgctgaccctcatcgtg
attttttactacctgggcttactgtgtggcgtgtgcggctatgacaggcatgccaccccg
accacccgaggctgtgtctccaacaccggaggcgtcttcctcatggttggagttggatta
agtttcctcttttgctggatattgatgatcattgtggttcttacctttgtctttggtgca
aatgtggaaaaactgatctgtgaaccttacacgagcaaggaattattccgggttttggat
acaccctacttactaaatgaagactgggaatactatctctctgggaagctatttaataaa
tcaaaaatgaagctcacttttgaacaagtttacagtgactgcaaaaaaaatagaggcact
tacggcactcttcacctgcagaacagcttcaatatcagtgaacatctcaacattaatgag
catactggaagcataagcagtgaattggaaagtctgaaggtaaatcttaatatctttctg
ttgggtgcagcaggaagaaaaaaccttcaggattttgctgcttgtggaatagacagaatg
aattatgacagctacttggctcagactggtaaatcccccgcaggagtgaatcttttatca
tttgcatatgatctagaagcaaaagcaaacagtttgcccccaggaaatttgaggaactcc
ctgaaaagagatgcacaaactattaaaacaattcaccagcaacgagtccttcctatagaa
caatcactgagcactctataccaaagcgtcaagatacttcaacgcacagggaatggattg
ttggagagagtaactaggattctagcttctctggattttgctcagaacttcatcacaaac
aatacttcctctgttattattgaggaaactaagaagtatgggagaacaataataggatat
tttgaacattatctgcagtggatcgagttctctatcagtgagaaagtggcatcgtgcaaa
cctgtggccaccgctctagatactgctgttgatgtctttctgtgtagctacattatcgac
cccttgaatttgttttggtttggcataggaaaagctactgtatttttacttccggctcta
atttttgcggtaaaactggctaagtactatcgtcgaatggattcggaggacgtgtacgat
gatgttgaaactatacccatgaaaaatatggaaaatggtaataatggttatcataaagat
catgtatatggtattcacaatcctgttatgacaagcccatcacaacattga

Protein Sequence

>8842 : length: 856
MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVH
IFLYVVQPRDFPEDTLRKFLQKAYESKIDYDKIVYYEAGIILCCVLGLLFIILMPLVGYF
FCMCRCCNKCGGEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVANHQVRTRIKR
SRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNI
IPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLV
HPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPD
RVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYIHRNLPTLEE
YDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGGVFLMVGVGL
SFLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNK
SKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFL
LGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNS
LKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITN
NTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIID
PLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKD
HVYGIHNPVMTSPSQH



')