Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8838

Name

WISP3

Synonym

CCN6|LIBC|PPAC|PPD;WNT1 inducible signaling pathway protein 3;WISP3;WNT1 inducible signaling pathway protein 3

Definition

CCN family member 6|WISP-3|WNT1-inducible-signaling pathway protein 3

Position

6q21

Gene Type

protein-coding

External Links

Links to Entrez Gene

8838

Links to all GeneRIF Items

8838

Links to iHOP

8838

Sequence Information

Nucleotide Sequence

>8838 : length: 1065
atgcaggggctcctcttctccactcttctgcttgctggcctggcacagttctgctgcagg
gtacagggcactggaccattagatacaacacctgaaggaaggcctggagaagtgtcagat
gcacctcagcgtaaacagttttgtcactggccctgcaaatgccctcagcagaagccccgt
tgccctcctggagtgagcctggtgagagatggctgtggatgctgtaaaatctgtgccaag
caaccaggggaaatctgcaatgaagctgacctctgtgacccacacaaagggctgtattgt
gactactcagtagacaggcctaggtacgagactggagtgtgtgcataccttgtagctgtt
gggtgcgagttcaaccaggtacattatcataatggccaagtgtttcagcccaaccccttg
ttcagctgcctctgtgtgagtggggccattggatgcacacctctgttcataccaaagctg
gctggcagtcactgctctggagctaaaggtggaaagaagtctgatcagtcaaactgtagc
ctggaaccattactacagcagctttcaacaagctacaaaacaatgccagcttatagaaat
ctcccacttatttggaaaaaaaaatgtcttgtgcaagcaacaaaatggactccctgctcc
agaacatgtgggatgggaatatctaacagggtgaccaatgaaaacagcaactgtgaaatg
agaaaagagaaaagactgtgttacattcagccttgcgacagcaatatattaaagacaata
aagattcccaaaggaaaaacatgccaacctactttccaactctccaaagctgaaaaattt
gtcttttctggatgctcaagtactcagagttacaaacccactttttgtggaatatgcttg
gataagagatgctgtatccctaataagtctaaaatgattactattcaatttgattgccca
aatgaggggtcatttaaatggaagatgctgtggattacatcttgtgtgtgtcagagaaac
tgcagagaacctggagatatattttctgagctcaagattctgtaa

Protein Sequence

>8838 : length: 354
MQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPR
CPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAV
GCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCS
LEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRTCGMGISNRVTNENSNCEM
RKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEKFVFSGCSSTQSYKPTFCGICL
DKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCREPGDIFSELKIL



')