Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8828

Name

NRP2

Synonym

NP2|NPN2|PRO2714|VEGF165R2;neuropilin 2;NRP2;neuropilin 2

Definition

neuropilin-2|neuropilin-2a(17)|neuropilin-2a(22)|neuropilin-2b(0)|receptor for VEGF165 and semaphorins class3|vascular endothelial cell growth factor 165 receptor 2

Position

2q33.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

NrCAM interactions;PID Reactome;500103

Pathway

Signaling by VEGF;Reactome;REACT:12529

Pathway

VEGFR1 specific signals;PID Curated;200151

Disease

PSYCH;GAD

Disease

Autistic disorder;FunDO

Disease

Cancer;FunDO

Disease

Autism;GAD

External Links

Links to Entrez Gene

8828

Links to all GeneRIF Items

8828

Links to iHOP

8828

Sequence Information

Nucleotide Sequence

>8828 : length: 2781
atggatatgtttcctctcacctgggttttcttagccctctacttttcaagacaccaagtg
agaggccaaccagacccaccgtgcggaggtcgtttgaattccaaagatgctggctatatc
acctctcccggttacccccaggactacccctcccaccagaactgcgagtggattgtttac
gcccccgaacccaaccagaagattgtcctcaacttcaaccctcactttgaaatcgagaag
cacgactgcaagtatgactttatcgagattcgggatggggacagtgaatccgcagacctc
ctgggcaaacactgtgggaacatcgccccgcccaccatcatctcctcgggctccatgctc
tacatcaagttcacctccgactacgcccggcagggggcaggcttctctctgcgctacgag
atcttcaagacaggctctgaagattgctcaaaaaacttcacaagccccaacgggaccatc
gaatctcctgggtttcctgagaagtatccacacaacttggactgcacctttaccatcctg
gccaaacccaagatggagatcatcctgcagttcctgatctttgacctggagcatgaccct
ttgcaggtgggagagggggactgcaagtacgattggctggacatctgggatggcattcca
catgttggccccctgattggcaagtactgtgggaccaaaacaccctctgaacttcgttca
tcgacggggatcctctccctgacctttcacacggacatggcggtggccaaggatggcttc
tctgcgcgttactacctggtccaccaagagccactagagaactttcagtgcaatgttcct
ctgggcatggagtctggccggattgctaatgaacagatcagtgcctcatctacctactct
gatgggaggtggacccctcaacaaagccggctccatggtgatgacaatggctggaccccc
aacttggattccaacaaggagtatctccaggtggacctgcgctttttaaccatgctcacg
gccatcgcaacacagggagcgatttccagggaaacacagaatggctactatgtcaaatcc
tacaagctggaagtcagcactaatggagaggactggatggtgtaccggcatggcaaaaac
cacaaggtatttcaagccaacaacgatgcaactgaggtggttctgaacaagctccacgct
ccactgctgacaaggtttgttagaatccgccctcagacctggcactcaggtatcgccctc
cggctggagctcttcggctgccgggtcacagatgctccctgctccaacatgctggggatg
ctctcaggcctcattgcagactcccagatctccgcctcttccacccaggaatacctctgg
agccccagtgcagcccgcctggtcagcagccgctcgggctggttccctcgaatccctcag
gcccagcccggtgaggagtggcttcaggtagatctgggaacacccaagacagtgaaaggt
gtcatcatccagggagcccgcggaggagacagtatcactgctgtggaagccagagcattt
gtgcgcaagttcaaagtctcctacagcctaaacggcaaggactgggaatacattcaggac
cccaggacccagcagccaaagctgttcgaagggaacatgcactatgacacccctgacatc
cgaaggtttgaccccattccggcacagtatgtgcgggtatacccggagaggtggtcgccg
gcggggattgggatgcggctggaggtgctgggctgtgactggacagactccaagcccacg
gtagagacgctgggacccactgtgaagagcgaagagacaaccaccccctaccccaccgaa
gaggaggccacagagtgtggggagaactgcagctttgaggatgacaaagatttgcagctc
ccttcgggattcaattgcaacttcgatttcctcgaggagccctgtggttggatgtatgac
catgccaagtggctccggaccacctgggccagcagctccagcccaaacgaccggacgttt
ccagatgacaggaatttcttgcggctgcagagtgacagccagagagagggccagtatgcc
cggctcatcagcccccctgtccacctgccccgaagcccggtgtgcatggagttccagtac
caggccacgggcggccgcggggtggcgctgcaggtggtgcgggaagccagccaggagagc
aagttgctgtgggtcatccgtgaggaccagggcggcgagtggaagcacgggcggatcatc
ctgcccagctacgacatggagtaccagattgtgttcgagggagtgatagggaaaggacgt
tccggagagattgccattgatgacattcggataagcactgatgtcccactggagaactgc
atggaacccatctcggcttttgcagtggacatcccagaaatacatgagagagaaggatat
gaagatgaaattgatgatgaatacgaggtggactggagcaattcttcttctgcaacctca
gggtctggcgccccctcgaccgacaaagaaaagagctggctgtacaccctggatcccatc
ctcatcaccatcatcgccatgagctcactgggcgtcctcctgggggccacctgtgcaggc
ctcctgctctactgcacctgttcctactcgggcctgagctcccgaagctgcaccacactg
gagaactacaacttcgagctctacgatggccttaagcacaaggtcaagatgaaccaccaa
aagtgctgctccgaggcatga

Protein Sequence

>8828 : length: 926
MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSML
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPTEEEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYD
HAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQY
QATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEIAIDDIRISTDVPLENCMEPISAFAVDIPEIHEREGYEDEIDDEYEVDWSNSSSATS
GSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTL
ENYNFELYDGLKHKVKMNHQKCCSEA



')