Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

873

Name

CBR1

Synonym

CBR|SDR21C1|hCBR1;carbonyl reductase 1;CBR1;carbonyl reductase 1

Definition

15-hydroxyprostaglandin dehydrogenase|NADPH-dependent carbonyl reductase 1|carbonyl reductase (NADPH) 1|carbonyl reductase [NADPH] 1|prostaglandin 9-ketoreductase|prostaglandin-E(2) 9-reductase|short chain dehydrogenase/reductase family 21C, member 1

Position

21q22.13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Arachidonic acid metabolism;KEGG PATHWAY;hsa00590

External Links

Links to Entrez Gene

873

Links to all GeneRIF Items

873

Links to iHOP

873

Sequence Information

Nucleotide Sequence

>873 : length: 834
atgtcgtccggcatccatgtagcgctggtgactggaggcaacaagggcatcggcttggcc
atcgtgcgcgacctgtgccggctgttctcgggggacgtggtgctcacggcgcgggacgtg
acgcggggccaggcggccgtacagcagctgcaggcggagggcctgagcccgcgcttccac
cagctggacatcgacgatctgcagagcatccgcgccctgcgcgacttcctgcgcaaggag
tacgggggcctggacgtgctggtcaacaacgcgggcatcgccttcaaggttgctgatccc
acaccctttcatattcaagctgaagtgacgatgaaaacaaatttctttggtacccgagat
gtgtgcacagaattactccctctaataaaaccccaagggagagtggtgaacgtatctagc
atcatgagcgtcagagcccttaaaagctgcagcccagagctgcagcagaagttccgcagt
gagaccatcactgaggaggagctggtggggctcatgaacaagtttgtggaggatacaaag
aagggagtgcaccagaaggagggctggcccagcagcgcatacggggtgacgaagattggc
gtcaccgttctgtccaggatccacgccaggaaactgagtgagcagaggaaaggggacaag
atcctcctgaatgcctgctgcccagggtgggtgagaactgacatggcgggacccaaggcc
accaagagcccagaagaaggtgcagagacccctgtgtacttggcccttttgcccccagat
gctgagggtccccatggacaatttgtttcagagaagagagttgaacagtggtga

Protein Sequence

>873 : length: 277
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFH
QLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD
VCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTK
KGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA
TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW



')