Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8668

Name

EIF3I

Synonym

EIF3S2|PRO2242|TRIP-1|TRIP1|eIF3-beta|eIF3-p36;eukaryotic translation initiation factor 3, subunit I;EIF3I;eukaryotic translation initiation factor 3, subunit I

Definition

TGF-beta receptor-interacting protein 1|TGFbeta receptor-interacting protein 1|eIF-3-beta|eIF3 p36|eukaryotic translation initiation factor 3 subunit 2|eukaryotic translation initiation factor 3 subunit I|eukaryotic translation initiation factor 3, subuni

Position

1p34.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

3' -UTR-mediated translational regulation;Reactome;REACT:1762

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Metabolism of proteins;Reactome;REACT:17015

External Links

Links to Entrez Gene

8668

Links to all GeneRIF Items

8668

Links to iHOP

8668

Sequence Information

Nucleotide Sequence

>8668 : length: 978
atgaagccgatcctactgcagggccatgagcggtccattacgcagattaagtataaccgc
gaaggagacctcctctttactgtggccaaggaccctatcgtcaatgtatggtactctgtg
aatggtgagaggctgggcacctacatgggccataccggagctgtgtggtgtgtggacgct
gactgggacaccaagcatgtcctcactggctcagctgacaacagctgtcgtctctgggac
tgtgaaacaggaaagcagctggcccttctcaagaccaattcggctgtccggacctgcggt
tttgactttgggggcaacatcatcatgttctccacggacaagcagatgggctaccagtgc
tttgtgagcttttttgacctgcgggatccgagccagattgacaacaatgagccctacatg
aagatcccttgcaatgactctaaaatcaccagtgctgtttggggacccctgggggagtgc
atcatcgctggccatgagagtggagagctcaaccagtatagtgccaagtctggagaggtg
ttggtgaatgttaaggagcactcccggcagatcaacgacatccagttatccagggacatg
accatgtttgtgaccgcgtccaaggacaacacagccaagctttttgactccacaactctt
gaacatcagaagactttccggacagaacgtcctgtcaactcagctgccctctcccccaac
tatgaccatgtggtcctgggcggtggtcaggaagccatggatgtaaccacaacctccacc
aggattggcaagtttgaggccaggttcttccatttggcctttgaagaagagtttggaaga
gtcaagggtcactttggacctatcaacagtgttgccttccatcctgatggcaagagctac
agcagcggcggcgaagatggttacgtccgtatccattacttcgacccacagtacttcgaa
tttgagtttgaggcttaa

Protein Sequence

>8668 : length: 325
MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA
DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC
FVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV
LVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPN
YDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY
SSGGEDGYVRIHYFDPQYFEFEFEA



')