Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8650

Name

NUMB

Synonym

C14orf41|S171;numb homolog (Drosophila);NUMB;numb homolog (Drosophila)

Definition

h-Numb|protein numb homolog

Position

14q24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

Notch signaling pathway;PANTHER;P00045

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

Axon guidance;Reactome;REACT:18266

Disease

coronary artery calcification;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Coronary artery calcification;NHGRI

External Links

Links to Entrez Gene

8650

Links to all GeneRIF Items

8650

Links to iHOP

8650

Sequence Information

Nucleotide Sequence

>8650 : length: 1956
atgaacaaattacggcaaagttttaggagaaagaaggatgtttatgttccagaggccagt
cgtccacatcagtggcagacagatgaagaaggcgttcgcaccggaaaatgtagcttcccg
gttaagtaccttggccatgtagaagttgatgaatcaagaggaatgcacatctgtgaagat
gctgtaaaaagattgaaagctgaaaggaagttcttcaaaggcttctttggaaaaactgga
aagaaagcagttaaagcagttctgtgggtctcagcagatggactcagagttgtggatgaa
aaaactaaggacctcatagttgaccagacgatagagaaagtttctttctgtgccccagac
aggaactttgatagagccttttcttacatatgccgtgatggcaccactcgtcgctggatc
tgtcactgcttcatggctgtcaaggacacaggtgaaaggttgagccatgcagtaggctgt
gcttttgcagcctgtttagagcgcaagcagaagcgggagaaggaatgtggagtgactgct
acttttgatgctagtcggaccacttttacaagagaaggatcattccgtgtcacaacagcc
actgaacaagcagaaagagaggagatcatgaaacaaatgcaagatgccaagaaagctgaa
acagataagatagtcgttggttcatcagttgcccctggcaacactgccccatccccatcc
tctcccacctctcctacttctgatgccacgacctctctggagatgaacaatcctcatgcc
atcccacgccggcatgctccaattgaacagcttgctcgccaaggctctttccgaggtttt
cctgctcttagccagaagatgtcaccctttaaacgccaactatccctacgcatcaatgag
ttgccttccactatgcagaggaagactgatttccccattaaaaatgcagtgccagaagta
gaaggggaggcagagagcatcagctccctgtgctcacagatcaccaatgccttcagcaca
cctgaggaccccttctcatctgctccgatgaccaaaccagtgacagtggtggcaccacaa
tctcctaccttccaagctaatggcactgactcagccttccatgtgcttgctaagccagcc
catactgctctagcacccgtagcaatgcctgtgcgtgaaaccaacccttgggcccatgcc
cctgatgctgctaacaaggaaattgcagccacatgttcggggaccgagtggggtcaatct
tctggtgctgcctctccaggtctcttccaggccggtcatagacgtactccctctgaggcc
gaccgatggttagaagaggtgtctaagagcgtccgggctcagcagccccaggcctcagct
gctcctctgcagccagttctccagcctcctccacccactgccatctcccagccagcatca
cctttccaagggaatgcattcctcacctctcagcctgtgccagtgggtgtggtcccagcc
ctgcaaccagcctttgtccctgcccagtcctatcctgtggccaatggaatgccctatcca
gcccctaatgtgcctgtggtgggcatcactccctcccagatggtggccaacgtatttggc
actgcaggccaccctcaggctgcccatccccatcagtcacccagcctggtcaggcagcag
acattccctcactacgaggcaagcagtgctaccaccagtcccttctttaagcctcctgct
cagcacctcaacggttctgcagctttcaatggtgtagatgatggcaggttggcctcagca
gacaggcatacagaggttcctacaggcacctgcccagtggatccttttgaagcccagtgg
gctgcattagaaaataagtccaagcagcgtactaatccctcccctaccaaccctttctcc
agtgacttacagaagacgtttgaaattgaactttaa

Protein Sequence

>8650 : length: 651
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED
AVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPD
RNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTA
TFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPS
SPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINE
LPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPMTKPVTVVAPQ
SPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS
SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPAS
PFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFG
TAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASA
DRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL



')