Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

864

Name

RUNX3

Synonym

AML2|CBFA3|PEBP2aC;runt-related transcription factor 3;RUNX3;runt-related transcription factor 3

Definition

CBF-alpha-3|PEA2 alpha C|PEA2-alpha C|PEBP2 alpha C|PEBP2-alpha C|SL3-3 enhancer factor 1 alpha C subunit|SL3/AKV core-binding factor alpha C subunit|acute myeloid leukemia 2 protein|acute myeloid leukemia gene 2|core-binding factor subunit alpha-3|core-b

Position

1p36

Gene Type

protein-coding

External Links

Links to Entrez Gene

864

Links to all GeneRIF Items

864

Links to iHOP

864

Sequence Information

Nucleotide Sequence

>864 : length: 1290
atggcatcgaacagcatcttcgactccttcccgacctactcgccgaccttcatccgcgac
ccaagcaccagccgccgcttcacacctccctccccggccttcccctgcggcggcggcggc
ggcaagatgggcgagaacagcggcgcgctgagcgcgcaggcggccgtggggcccggaggg
cgcgcccggcccgaggtgcgctcgatggtggacgtgctggcggaccacgcaggcgagctc
gtgcgcaccgacagccccaacttcctctgctccgtgctgccctcgcactggcgctgcaac
aagacgctgcccgtcgccttcaaggtggtggcattgggggacgtgccggatggtacggtg
gtgactgtgatggcaggcaatgacgagaactactccgctgagctgcgcaatgcctcggcc
gtcatgaagaaccaggtggccaggttcaacgaccttcgcttcgtgggccgcagtgggcga
gggaagagtttcaccctgaccatcactgtgttcaccaaccccacccaagtggcgacctac
caccgagccatcaaggtgaccgtggacggaccccgggagcccagacggcaccggcagaag
ctggaggaccagaccaagccgttccctgaccgctttggggacctggaacggctgcgcatg
cgggtgacaccgagcacacccagcccccgaggctcactcagcaccacaagccacttcagc
agccagccccagaccccaatccaaggcacctcggaactgaacccattctccgacccccgc
cagtttgaccgctccttccccacgctgccaaccctcacggagagccgcttcccagacccc
aggatgcattatcccggggccatgtcagctgccttcccctacagcgccacgccctcgggc
acgagcatcagcagcctcagcgtggcgggcatgccggccaccagccgcttccaccatacc
tacctcccgccaccctacccgggggccccgcagaaccagagcgggcccttccaggccaac
ccgtccccctaccacctctactacgggacatcctctggctcctaccagttctccatggtg
gccggcagcagcagtgggggcgaccgctcacctacccgcatgctggcctcttgcaccagc
agcgctgcctctgtcgccgccggcaacctcatgaaccccagcctgggcggccagagtgat
ggcgtggaggccgacggcagccacagcaactcacccacggccctgagcacgccaggccgc
atggatgaggccgtgtggcggccctactga

Protein Sequence

>864 : length: 429
MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGG
RARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTV
VTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATY
HRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFS
SQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSG
TSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMV
AGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGR
MDEAVWRPY



')