Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8626

Name

TP63

Synonym

AIS|B(p51A)|B(p51B)|EEC3|KET|LMS|NBP|OFC8|RHS|SHFM4|TP53CP|TP53L|TP73L|p40|p51|p53CP|p63|p73H|p73L;tumor protein p63;TP63;tumor protein p63

Definition

CUSP|amplified in squamous cell carcinoma|chronic ulcerative stomatitis protein|keratinocyte transcription factor KET|transformation-related protein 63|tumor protein 63|tumor protein p53-competing protein|tumor protein p63 deltaN isoform delta

Position

3q28

Gene Type

protein-coding

Pathways and Diseases

Pathway

p53 pathway;PANTHER;P00059

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

p53 pathway by glucose deprivation;PANTHER;P04397

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Huntington disease;PANTHER;P00029

Pathway

P53 pathway feedback loops 1;PANTHER;P04392

Disease

urinary bladder cancer;GAD

Disease

Rapp-Hodgkin syndrome;OMIM

Disease

Orofacial cleft 8;OMIM

Disease

Split-hand/foot malformation, type 4;OMIM

Disease

Limb-mammary syndrome;OMIM

Disease

Hay-Wells syndrome;OMIM

Disease

Lung adenocarcinoma;NHGRI

Disease

ADULT syndrome;OMIM

Disease

CANCER;GAD

Disease

Brain imaging;NHGRI

Disease

Ectrodactyly, ectodermal dysplasia, and cleft lip/palate syndrome 3;OMIM

Disease

Brain imaging;GAD

Disease

proliferative potential of keratinocytes;GAD

Disease

Urinary bladder cancer;NHGRI

Disease

blastic crisis;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to Entrez Gene

8626

Links to all GeneRIF Items

8626

Links to iHOP

8626

Sequence Information

Nucleotide Sequence

>8626 : length: 1668
atgaattttgaaacttcacggtgtgccaccctacagtactgccctgacccttacatccag
cgtttcgtagaaaccccagctcatttctcttggaaagaaagttattaccgatccaccatg
tcccagagcacacagacaaatgaattcctcagtccagaggttttccagcatatctgggat
tttctggaacagcctatatgttcagttcagcccattgacttgaactttgtggatgaacca
tcagaagatggtgcgacaaacaagattgagattagcatggactgtatccgcatgcaggac
tcggacctgagtgaccccatgtggccacagtacacgaacctggggctcctgaacagcatg
gaccagcagattcagaacggctcctcgtccaccagtccctataacacagaccacgcgcag
aacagcgtcacggcgccctcgccctacgcacagcccagctccaccttcgatgctctctct
ccatcacccgccatcccctccaacaccgactacccaggcccgcacagtttcgacgtgtcc
ttccagcagtcgagcaccgccaagtcggccacctggacgtattccactgaactgaagaaa
ctctactgccaaattgcaaagacatgccccatccagatcaaggtgatgaccccacctcct
cagggagctgttatccgcgccatgcctgtctacaaaaaagctgagcacgtcacggaggtg
gtgaagcggtgccccaaccatgagctgagccgtgaattcaacgagggacagattgcccct
cctagtcatttgattcgagtagaggggaacagccatgcccagtatgtagaagatcccatc
acaggaagacagagtgtgctggtaccttatgagccaccccaggttggcactgaattcacg
acagtcttgtacaatttcatgtgtaacagcagttgtgttggagggatgaaccgccgtcca
attttaatcattgttactctggaaaccagagatgggcaagtcctgggccgacgctgcttt
gaggcccggatctgtgcttgcccaggaagagacaggaaggcggatgaagatagcatcaga
aagcagcaagtttcggacagtacaaagaacggtgatggtacgaagcgcccgtttcgtcag
aacacacatggtatccagatgacatccatcaagaaacgaagatccccagatgatgaactg
ttatacttaccagtgaggggccgtgagacttatgaaatgctgttgaagatcaaagagtcc
ctggaactcatgcagtaccttcctcagcacacaattgaaacgtacaggcaacagcaacag
cagcagcaccagcacttacttcagaaacagacctcaatacagtctccatcttcatatggt
aacagctccccacctctgaacaaaatgaacagcatgaacaagctgccttctgtgagccag
cttatcaaccctcagcagcgcaacgccctcactcctacaaccattcctgatggcatggga
gccaacattcccatgatgggcacccacatgccaatggctggagacatgaatggactcagc
cccacccaggcactccctcccccactctccatgccatccacctcccactgcacaccccca
cctccgtatcccacagattgcagcattgtcaggatctggcaagtctga

Protein Sequence

>8626 : length: 555
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVRIWQV



')