Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8487

Name

GEMIN2

Synonym

SIP1|SIP1-delta;gem (nuclear organelle) associated protein 2;GEMIN2;gem (nuclear organelle) associated protein 2

Definition

SMN interacting protein 1-delta|component of gems 2|gem-associated protein 2|gemin-2|survival of motor neuron protein interacting protein 1

Position

14q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

snRNP Assembly;PID Reactome;500858

Pathway

Metabolism of RNA;Reactome;REACT:21257

External Links

Links to Entrez Gene

8487

Links to all GeneRIF Items

8487

Links to iHOP

8487

Sequence Information

Nucleotide Sequence

>8487 : length: 798
atgcgccgagcggaactggctggtttgaaaaccatggcgtgggtaccagcggagtccgca
gtggaagagttgatgcctcggctattgccggtagagccttgcgacttgacggaaggtttc
gatccctcggtacccccgaggacgcctcaggaatacctgaggcgggtccagatcgaagca
gctcaatgtccagatgttgtggtagctcaaattgacccaaagaagttgaaaaggaagcaa
agtgtgaatatttctctttcaggatgccaacccgcccctgaaggttattccccaacactt
caatggcaacagcaacaagtggcacagttttcaactgttcgacagaatgtgaacaaacat
agaagtcactggaaatcacaacagttggatagtaatgtgacaatgccaaaatctgaagat
gaagaaggctggaagaaattttgtctgggtgaaaagttatgtgctgacggggctgttgga
ccagccacaaatgaaagtcctggaatagattatgtacaagcaacagtaactagtgtcttg
gaatatctgagtaattggtttggagaaagagactttactccagaattgggaagatggctt
tatgctttattggcttgtcttgaaaagcctttgttacctgaggctcattcactgattcgg
cagcttgcaagaaggtgctctgaagtgaggctcttagtggatagcaaagatgatgagagg
gttcctgctttgaatttattaatctgcttggttagcaggtattttgaccaacgtgattta
gctgatgagccatcttga

Protein Sequence

>8487 : length: 265
MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEA
AQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKH
RSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQATVTSVL
EYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDER
VPALNLLICLVSRYFDQRDLADEPS



')