Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8482

Name

SEMA7A

Synonym

CD108|CDw108|H-SEMA-K1|H-Sema-L|JMH|SEMAK1|SEMAL;semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group);SEMA7A;semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)

Definition

JMH blood group antigen|John Milton Hagen blood group H-Sema K1|john-Milton-Hargen human blood group Ag|sema K1|sema L|sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin) 7A (JMH blood group)|sema domain, immunoglobulin domain (

Position

15q22.3-q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Other semaphorin interactions;PID Reactome;500078

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Axon guidance;Reactome;REACT:18266

Disease

Blood group, John-Milton-Hagen;OMIM

External Links

Links to Entrez Gene

8482

Links to all GeneRIF Items

8482

Links to iHOP

8482

Sequence Information

Nucleotide Sequence

>8482 : length: 1959
atgacgcctcctccgcccggacgtgccgcccccagcgcaccgcgcgcccgcgtccctggc
ccgccggctcggttggggcttccgctgcggctgcggctgctgctgctgctctgggcggcc
gccgcctccgcccagggccacctaaggagcggaccccgcatcttcgccgtctggaaaggc
catgtagggcaggaccgggtggactttggccagactgagccgcacacggtgcttttccac
gagccaggcagctcctctgtgtgggtgggaggacgtggcaaggtctacctctttgacttc
cccgagggcaagaacgcatctgtgcgcacggactgcgagaactacatcactctcctggag
aggcggagtgaggggctgctggcctgtggcaccaacgcccggcaccccagctgctggaac
ctggtgaatggcactgtggtgccacttggcgagatgagaggctacgcccccttcagcccg
gacgagaactccctggttctgtttgaaggggacgaggtgtattccaccatccggaagcag
gaatacaatgggaagatccctcggttccgccgcatccggggcgagagtgagctgtacacc
agtgatactgtcatgcagaacccacagttcatcaaagccaccatcgtgcaccaagaccag
gcttacgatgacaagatctactacttcttccgagaggacaatcctgacaagaatcctgag
gctcctctcaatgtgtcccgtgtggcccagttgtgcaggggggaccagggtggggaaagt
tcactgtcagtctccaagtggaacacttttctgaaagccatgctggtatgcagtgatgct
gccaccaacaagaacttcaacaggctgcaagacgtcttcctgctccctgaccccagcggc
cagtggagggacaccagggtctatggtgttttctccaacccctggaactactcagccgtc
tgtgtgtattccctcggtgacattgacaaggtcttccgtacctcctcactcaagggctac
cactcaagccttcccaacccgcggcctggcaagtgcctcccagaccagcagccgataccc
acagagaccttccaggtggctgaccgtcacccagaggtggcgcagagggtggagcccatg
gggcctctgaagacgccattgttccactctaaataccactaccagaaagtggccgtccac
cgcatgcaagccagccacggggagacctttcatgtgctttacctaactacagacaggggc
actatccacaaggtggtggaaccgggggagcaggagcacagcttcgccttcaacatcatg
gagatccagcccttccgccgcgcggctgccatccagaccatgtcgctggatgctgagcgg
aggaagctgtatgtgagctcccagtgggaggtgagccaggtgcccctggacctgtgtgag
gtctatggcgggggctgccacggttgcctcatgtcccgagacccctactgcggctgggac
caaggccgctgcatctccatctacagctccgaacggtcagtgctgcaatccattaatcca
gccgagccacacaaggagtgtcccaaccccaaaccagacaaggccccactgcagaaggtt
tccctggccccaaactctcgctactacctgagctgccccatggaatcccgccacgccacc
tactcatggcgccacaaggagaacgtggagcagagctgcgaacctggtcaccagagcccc
aactgcatcctgttcatcgagaacctcacggcgcagcagtacggccactacttctgcgag
gcccaggagggctcctacttccgcgaggctcagcactggcagctgctgcccgaggacggc
atcatggccgagcacctgctgggtcatgcctgtgccctggccgcctccctctggctgggg
gtgctgcccacactcactcttggcttgctggtccactag

Protein Sequence

>8482 : length: 652
MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKG
HVGQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTDCENYITLLE
RRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGDEVYSTIRKQ
EYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPE
APLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNFNRLQDVFLLPDPSG
QWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPNPRPGKCLPDQQPIP
TETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGETFHVLYLTTDRG
TIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQWEVSQVPLDLCE
VYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKV
SLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCE
AQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLTLGLLVH



')