Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8313

Name

AXIN2

Synonym

AXIL;axin 2;AXIN2;axin 2

Definition

axin-2|axin-like protein|axis inhibition protein 2|conductin

Position

17q23-q24

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Canonical Wnt signaling pathway;PID Curated;200064

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Disease

Oligodontia-colorectal cancer syndrome;OMIM

Disease

Colorectal cancer;OMIM

External Links

Links to Entrez Gene

8313

Links to all GeneRIF Items

8313

Links to iHOP

8313

Sequence Information

Nucleotide Sequence

>8313 : length: 2532
atgagtagcgctatgttggtgacttgcctcccggaccccagcagcagcttccgtgaggat
gccccgcggcccccagtgccaggggaagaaggggagaccccaccgtgtcagccaggggtg
ggcaagggccaggtcaccaaacccatgcctgtctcttccaacaccaggcggaacgaagat
gggttgggggagccggaggggcgggcatctccggattcccctctgacccggtggaccaag
tccttacactccttattgggcgatcaagacggtgcttacctgttccgaactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcattgtctccaagcagctgaagcctgccaccaagacctacataagagatggc
atcaagaagcagcagattgattccatcatgtttgaccaggcgcagaccgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaatgggggactcgggagcctaaaggtc
gtgtgtggctatctccccaccttgaatgaagaagaggagtggacttgtgccgacttcaag
tgcaaactttcgccaaccgtggttggcttgtccagcaaaactctgagggccacggcgagt
gtgaggtccacggaaactgttgacagtggatacaggtccttcaagaggagcgatcctgtt
aatccttatcacataggttctggctatgtctttgcaccagccaccagcgccaacgacagt
gagatatccagtgatgcgctgacggatgattccatgtccatgacggacagcagtgtagat
ggaattcctccttatcgtgtgggcagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggaacccgccacctttgcagctgagctgatctcgaggctggaaaag
ctgaagctggagttggagagccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagagagagggctccgagctcacactcaattcgcgggagggggcgcccacgcag
caccccctctccctactgccctccggcagctacgaggaagacccgcagacgatactggac
gatcacctgtccagggtcctcaagacccctggctgccagtctccaggcgtaggccgctat
agcccccgctcccgctccccggaccaccaccaccaccaccattcgcagtaccactccctg
ctcccgcccggtggcaagctgcctcccgcggccgcctcgccgggcgcctgccccctcctc
gggggcaaaggctttgtgaccaagcagacgacgaagcatgtccaccaccactacatccac
caccatgccgtccccaagaccaaggaggagatcgaggcggaggccacgcagcgggtgcac
tgcttctgccctgggggcagcgagtattactgctactcgaaatgcaaaagccactccaag
gctccggaaaccatgcccagcgagcagtttggcggcagcagaggcagtaccttgcccaaa
cgcaatgggaaaggcacggagccgggcctggccctgcccgccagggaaggaggggccccc
ggcggagctggggccctgcagcttccccgggaggaaggagacaggtcgcaggatgtctgg
cagtggatgctggagagtgagcggcagagcaagcccaagccccatagtgcccaaagcaca
aaaaaggcctaccccttggagtctgcccgctcgtctccaggcgaacgagccagccggcac
catctgtgggggggcaacagcgggcacccccgcaccaccccccgtgcccacctgttcacc
caggaccctgcgatgcctcccctgaccccacccaacacgctggctcagctggaggaggcc
tgtcgcaggctagctgaggtgtcgaagcccccaaagcagcggtgctgtgtggccagtcag
cagagggacaggaatcattcggccactgttcagacgggagccacacccttctccaatcca
agcctggctccagaagatcacaaagagccaaagaaactggcaggtgtccacgcgctccag
gccagtgagttggttgtcacttactttttctgtggggaagaaattccataccggaggatg
ctgaaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagcaagcgatgagtttgcctgtggagcggtgtttgaggag
atctgggaggatgagacggtgctcccgatgtatgaaggccggattctgggcaaagtggag
cggatcgattga

Protein Sequence

>8313 : length: 843
MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSL
LPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVH
CFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRH
HLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID



')