Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8312

Name

AXIN1

Synonym

AXIN|PPP1R49;axin 1;AXIN1;axin 1

Definition

axin-1|axis inhibition protein 1|axis inhibitor 1|fused, mouse, homolog of|protein phosphatase 1, regulatory subunit 49

Position

16p13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Degradation of beta-catenin by the destruction complex;PID Reactome;500310

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

Canonical Wnt signaling pathway;PID Curated;200064

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Signaling by Wnt;Reactome;REACT:11045

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Angiogenesis;PANTHER;P00005

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

segmentation clock;PID BioCarta;100146

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

C-MYC pathway;PID Curated;200093

Disease

Caudal duplication anomaly;OMIM

Disease

Hepatocellular carcinoma, somatic;OMIM

Disease

Cancers;KEGG DISEASE

Disease

Hepatocellular carcinoma;KEGG DISEASE;H00048

Disease

Cancers of the digestive system;KEGG DISEASE

External Links

Links to Entrez Gene

8312

Links to all GeneRIF Items

8312

Links to iHOP

8312

Sequence Information

Nucleotide Sequence

>8312 : length: 2589
atgaatatccaagagcagggtttccccttggacctcggagcaagtttcaccgaagatgct
ccccgacccccagtgcctggtgaggagggagaactggtgtccacagacccgaggcccgcc
agctacagtttctgctccgggaaaggtgttggcattaaaggtgagacttcgacggccact
ccgaggcgctcggatctggacctggggtatgagcctgagggcagtgcctcccccacccca
ccatacttgaagtgggctgagtcactgcattccctgctggatgaccaagatgggataagc
ctgttcaggactttcctgaagcaggagggctgtgccgacttgctggacttctggtttgcc
tgcactggcttcaggaagctggagccctgtgactcgaacgaggagaagaggctgaagctg
gcgagagccatctaccgaaagtacattcttgataacaatggcatcgtgtcccggcagacc
aagccagccaccaagagcttcataaagggctgcatcatgaagcagctgatcgatcctgcc
atgtttgaccaggcccagaccgaaatccaggccactatggaggaaaacacctatccctcc
ttccttaagtctgatatttatttggaatatacgaggacaggctcggagagccccaaagtc
tgtagtgaccagagctctgggtcagggacagggaagggcatatctggatacctgccgacc
ttaaatgaagatgaggaatggaagtgtgaccaggacatggatgaggacgatggcagagac
gctgctccccccggaagactccctcagaagctgctcctggagacagctgccccgagggtc
tcctccagtagacggtacagcgaaggcagagagttcaggtatggatcctggcgggagcca
gtcaacccctattatgtcaatgccggctatgccctggccccagccaccagtgccaacgac
agcgagcagcagagcctgtccagcgatgcagacaccctgtccctcacggacagcagcgtg
gatgggatccccccatacaggatccgtaagcagcaccgcagggagatgcaggagagcgtg
caggtcaatgggcgggtgcccctacctcacattccccgcacgtaccgggtgccgaaggag
gtccgcgtggagcctcagaagttcgcggaggagctcatccaccgcctggaggctgtgcag
cgcacgcgggaggccgaggagaagctggaggagcggctgaagcgcgtgcgcatggaggag
gaaggtgaggacggcgatccatcgtcagggcccccagggccgtgtcacaagctgcctccc
gcccccgcttggcaccacttcccgccccgctgtgtggacatgggctgtgccgggctccgg
gatgcacacgaggagaaccctgagagcatcctggacgagcacgtacagcgtgtgctgagg
acacctggccgccagtcgcctgggcctggccatcgctccccggacagtgggcacgtggcc
aagatgccagtggcactggggggtgccgcctcggggcacgggaagcacgtacccaagtca
ggggcgaagctggacgcggccggcctgcaccaccaccgacacgtccaccaccacgtccac
cacagcacagcccggcccaaggagcaggtggaggccgaggccacccgcagggcccagagc
agcttcgcctggggcctggaaccacacagccatggggcaaggtcccgaggctactcagag
agtgttggcgctgcccccaacgccagtgatggcctcgcccacagtgggaaggtgggcgtg
gcgtgcaaaagaaatgccaagaaggctgagtcggggaagagcgccagcaccgaggtgcca
ggtgcctcggaggatgcggagaagaaccagaaaatcatgcagtggatcattgagggggaa
aaggagatcagcaggcaccgcaggaccggccacgggtcttcggggacgaggaagccacag
ccccatgagaactccagacccttgtcccttgagcacccctgggccggccctcagctccgg
acctccgtgcagccctcccacctcttcatccaagaccccaccatgccaccccacccagct
cccaaccccctaacccagctggaggaggcgcgccgacgtctggaggaggaagaaaagaga
gccagccgagcaccctccaagcagaggtatgtgcaggaggttatgcggcggggacgcgcc
tgcgtcaggccagcgtgcgcgccggtgctgcacgtggtaccagccgtgtcggacatggag
ctctccgagacagagacaagatcgcagaggaaggtgggcggcgggagtgcccagccgtgt
gacagcatcgttgtggcgtactacttctgcggggaacccatcccctaccgcaccctggtg
aggggccgcgctgtcaccctgggccagttcaaggagctgctgaccaaaaagggcagctac
agatactacttcaagaaagtgagcgacgagtttgactgtggggtggtgtttgaggaggtt
cgagaggacgaggccgtcctgcccgtctttgaggagaagatcatcggcaaagtggagaag
gtggactga

Protein Sequence

>8312 : length: 862
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT
LNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLR
TPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVH
HSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGV
ACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQ
PHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKR
ASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPC
DSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEV
REDEAVLPVFEEKIIGKVEKVD



')