Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8091

Name

HMGA2

Synonym

BABL|HMGI-C|HMGIC|LIPO|STQTL9;high mobility group AT-hook 2;HMGA2;high mobility group AT-hook 2

Definition

High-mobility group protein HMGI-C|high mobility group AT-hook protein 2|high mobility group protein HMGI-C|high-mobility group (nonhistone chromosomal) protein isoform I-C

Position

12q15

Gene Type

protein-coding

External Links

Links to Entrez Gene

8091

Links to all GeneRIF Items

8091

Links to iHOP

8091

Sequence Information

Nucleotide Sequence

>8091 : length: 330
atgagcgcacgcggtgagggcgcggggcagccgtccacttcagcccagggacaacctgcc
gccccagcgcctcagaagagaggacgcggccgccccaggaagcagcagcaagaaccaacc
ggtgagccctctcctaagagacccaggggaagacccaaaggcagcaaaaacaagagtccc
tctaaagcagctcaaaagaaagcagaagccactggagaaaaacggccaagaggcagacct
aggaaatggccacaacaagttgttcagaagaagcctgctcaggaggaaactgaagagaca
tcctcacaagagtctgccgaagaggactag

Protein Sequence

>8091 : length: 109
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED



')