Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

8061

Name

FOSL1

Synonym

FRA|FRA1|fra-1;FOS-like antigen 1;FOSL1;FOS-like antigen 1

Definition

FOS-like antigen-1|fos-related antigen 1

Position

11q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Calcium signaling in the CD4+ TCR pathway;PID Curated;200159

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

bone remodeling;PID BioCarta;100052

External Links

Links to Entrez Gene

8061

Links to all GeneRIF Items

8061

Links to iHOP

8061

Sequence Information

Nucleotide Sequence

>8061 : length: 816
atgttccgagacttcggggaacccggcccgagctccgggaacggcggcgggtacggcggc
cccgcgcagcccccggccgcagcgcaggcagcccagcagaagttccacctggtgccaagc
atcaacaccatgagtggcagtcaggagctgcagtggatggtacagcctcatttcctgggg
cccagcagttaccccaggcctctgacctaccctcagtacagccccccacaaccccggcca
ggagtcatccgggccctggggccgcctccaggggtacgtcgaaggccttgtgaacagatc
agcccggaggaagaggagcgccgccgagtaaggcgcgagcggaacaagctggctgcggcc
aagtgcaggaaccggaggaaggaactgaccgacttcctgcaggcggagactgacaaactg
gaagatgagaaatctgggctgcagcgagagattgaggagctgcagaagcagaaggagcgc
ctagagctggtgctggaagcccaccgacccatctgcaaaatcccggaaggagccaaggag
ggggacacaggcagtaccagtggcaccagcagcccaccagccccctgccgccctgtacct
tgtatctccctttccccagggcctgtgcttgaacctgaggcactgcacacccccacactc
atgaccacaccctccctaactcctttcacccccagcctggtcttcacctaccccagcact
cctgagccttgtgcctcagctcatcgcaagagtagcagcagcagcggagacccatcctct
gacccccttggctctccaaccctcctcgctttgtga

Protein Sequence

>8061 : length: 271
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLG
PSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAA
KCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKE
GDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST
PEPCASAHRKSSSSSGDPSSDPLGSPTLLAL



')