Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

80237

Name

ELL3

Synonym

-;elongation factor RNA polymerase II-like 3;ELL3;elongation factor RNA polymerase II-like 3

Definition

RNA polymerase II elongation factor ELL3

Position

15q15.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

80237

Links to all GeneRIF Items

80237

Links to iHOP

80237

Sequence Information

Nucleotide Sequence

>80237 : length: 1194
atggaggagctccaggagcctctgagaggacagctccggctctgcttcacgcaagctgcc
cggactagcctcttactgctcaggctcaacgacgctgccctgcgggcgctgcaagagtgt
cagcggcaacaggtacggccggtgattgctttccaaggccaccgagggtatctgagactc
ccaggccctggttggtcctgcctcttctccttcatagtgtcccagtgttgtcaggagggc
gctggtggtagcttggaccttgtgtgccaacgcttcctcaggtctgggcctaacagcctc
cactgcctgggctcactcagggagcgcctcattatttgggcagccatggattctatccca
gccccatcatcagttcagggacacaacctgactgaagatgccagacatcctgagagttgg
cagaacacaggaggctattctgaaggagatgcagtatcacagccacagatggcactagag
gaggtgtcagtgtcagatccactggcaagcaaccaaggacagtcactcccaggatcctca
agggagcacatggcacagtgggaagtgagaagccagacccatgttccaaacagagaacct
gttcaggcactgccttcctctgccagccggaaacgtctggacaagaaacgttcagtgcct
gtagccactgtagaactggaagaaaagaggttcagaactctgcctttagtgccaagcccc
ctacaaggcctgaccaatcaggatttacaagagggagaagattgggagcaagaagatgag
gacatggaccccagattagaacacagttcctcagttcaagaagattctgaatccccaagt
cctgaagatataccagactacctcctgcaatacagggccatccacagtgcagaacagcaa
catgcctatgagcaggactttgagacagattatgctgaataccgcatcctgcatgcccgt
gttgggactgcaagccaaaggttcatagagctgggagcagagattaaaagagttcggcga
ggaactccagaatacaaggtcctggaagacaagataatccaggaatataaaaagttcagg
aagcagtacccaagttacagagaagaaaagcgtcgctgtgagtaccttcaccagaaattg
tcccacattaaaggtctcatcctggagtttgaggaaaagaacaggggcagctga

Protein Sequence

>80237 : length: 397
MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRL
PGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIP
APSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSS
REHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSP
LQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQ
HAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFR
KQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS



')