Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

80004

Name

ESRP2

Synonym

RBM35B;epithelial splicing regulatory protein 2;ESRP2;epithelial splicing regulatory protein 2

Definition

RNA binding motif protein 35A|RNA binding motif protein 35B|RNA-binding motif protein 35B|RNA-binding protein 35B

Position

16q22.1

Gene Type

protein-coding

External Links

Links to Entrez Gene

80004

Links to all GeneRIF Items

80004

Links to iHOP

80004

Sequence Information

Nucleotide Sequence

>80004 : length: 2154
atgactccgccgccgccgccgccccctcccccgggccctgaccccgcggccgaccccgcc
gcggacccctgcccctggcccggatcactggtcgtcctcttcggggctacggcgggtgcg
ctgggacgggacctgggctcggacgagaccgacttaatcctcctagtttggcaagtggtt
gagccgcggagccgccaggtggggacgctgcacaaatcgctggttcgtgccgaggcggcc
gcactgagtacgcagtgccgcgaggcgagcggcctgagcgccgacagcctggcgcgggca
gagccgctggacaaggtgctgcagcagttctcacagctggtgaacggggatgtggctttg
ctgggcgggggcccctacatgctctgcactgatgggcagcagctattgcgacaggtcctg
caccccgaggcctccaggaagaacctggtgctccccgacatgttcttctccttctatgac
ctccgaagagaattccatatgcagcatccaagcacctgccctgccagggacctcactgtg
gccaccatggcacagggtttaggactggagacagatgccacagaggatgactttggggtc
tgggaagtcaagacaatggtagctgttatcctccatctactcaaagagcccagcagtcaa
ttgttttcgaagcccgaggtgataaagcagaaatacgagacggggccttgcagcaaggct
gatgtggtggacagtgagactgtggtacgggctcgtgggttgccgtggcagtcatcagac
caggacgtggctcgcttcttcaaagggctcaacgtggccaggggtggtgtagcactctgc
ctcaacgcccagggccgcagaaatggcgaggccctcatccgctttgtggacagcgagcag
cgggacctagcgctgcagagacacaagcaccacatgggcgtccgctatattgaggtgtat
aaagcgacaggggaggagtttgtaaagattgcagggggcacatcactagaggtggctcgt
ttcttgtcacgggaagaccaagtgatcctgcggctgcggggactgcccttctcggctggg
ccaacggacgtgcttggcttcctggggccagagtgcccagtgactgggggtaccgagggg
ctgctctttgtgcgccatcctgatggccggccgactggtgatgccttcgccctctttgct
tgtgaggagctggcacaggctgcactgcgcaggcacaagggcatgctgggtaagcgatac
attgaactcttccggagcactgcagccgaagtgcagcaggtcttgaaccgctatgcatcc
ggcccactccttcctacactgactgccccactgctgcccatccccttcccactggcacct
gggactgggagggactgtgtacgcctccgaggcctgccctacacggccaccattgaagac
atcctgagctttctgggggaggcagcagctgacattcggccccacggtgtacacatggtg
ctcaaccagcagggccggccatcgggcgatgccttcattcagatgacatcagcagagcga
gccctagctgctgctcagcgttgccataagaaggtgatgaaggagcgctacgtggaggtg
gtcccctgttccacagaggagatgagccgagtgctgatggggggcaccttgggccgcagt
ggcatgtcccctccaccctgcaagctgccctgcctctcaccacctacctacaccaccttc
caagccaccccaacgctcattcccacggagacggcagctctatacccctcttcagcactg
ctcccagctgccagggtgcctgctgcccccacccctgttgcctactatccagggccagcc
actcaactctacctgaactacacagcctactacccaagccccccagtctcccccaccact
gtgggctacctcactacacccactgctgccctggcctctgctcccacctcagtgttgtcc
cagtcaggagccttggtccgcatgcagggtgtcccatacacggctggtatgaaggatctg
ctcagcgtcttccaggcctaccagctacccgctgatgactacaccagtctgatgcctgtt
ggtgacccacctcgcactgtgttacaagcccccaaggaatgggtgtgtttgtag

Protein Sequence

>80004 : length: 717
MTPPPPPPPPPGPDPAADPAADPCPWPGSLVVLFGATAGALGRDLGSDETDLILLVWQVV
EPRSRQVGTLHKSLVRAEAAALSTQCREASGLSADSLARAEPLDKVLQQFSQLVNGDVAL
LGGGPYMLCTDGQQLLRQVLHPEASRKNLVLPDMFFSFYDLRREFHMQHPSTCPARDLTV
ATMAQGLGLETDATEDDFGVWEVKTMVAVILHLLKEPSSQLFSKPEVIKQKYETGPCSKA
DVVDSETVVRARGLPWQSSDQDVARFFKGLNVARGGVALCLNAQGRRNGEALIRFVDSEQ
RDLALQRHKHHMGVRYIEVYKATGEEFVKIAGGTSLEVARFLSREDQVILRLRGLPFSAG
PTDVLGFLGPECPVTGGTEGLLFVRHPDGRPTGDAFALFACEELAQAALRRHKGMLGKRY
IELFRSTAAEVQQVLNRYASGPLLPTLTAPLLPIPFPLAPGTGRDCVRLRGLPYTATIED
ILSFLGEAAADIRPHGVHMVLNQQGRPSGDAFIQMTSAERALAAAQRCHKKVMKERYVEV
VPCSTEEMSRVLMGGTLGRSGMSPPPCKLPCLSPPTYTTFQATPTLIPTETAALYPSSAL
LPAARVPAAPTPVAYYPGPATQLYLNYTAYYPSPPVSPTTVGYLTTPTAALASAPTSVLS
QSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL



')