Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7852

Name

CXCR4

Synonym

CD184|D2S201E|FB22|HM89|HSY3RR|LAP3|LCR1|LESTR|NPY3R|NPYR|NPYRL|NPYY3R|WHIM;chemokine (C-X-C motif) receptor 4;CXCR4;chemokine (C-X-C motif) receptor 4

Definition

C-X-C chemokine receptor type 4|CD184 antigen|CXC-R4|CXCR-4|SDF-1 receptor|fusin|leukocyte-derived seven transmembrane domain receptor|leukocyte-derived seven-transmembrane-domain receptor|lipopolysaccharide-associated protein 3|neuropeptide Y receptor Y3

Position

2q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

pertussis toxin-insensitive ccr5 signaling in macrophage;PID BioCarta;100214

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

cxcr4 signaling pathway;PID BioCarta;100192

Pathway

Axon guidance mediated by Slit/Robo;PANTHER;P00008

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

beta-arrestins in gpcr desensitization;PID BioCarta;100231

Pathway

Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672

Disease

WHIM syndrome;OMIM

Disease

Multiple sclerosis;NHGRI

Disease

Myelokathexis, isolated;OMIM

Disease

Chemokine receptor defect;KEGG DISEASE;H00097

Disease

multiple sclerosis;GAD

Disease

Telomere length;NHGRI

Disease

IMMUNE;GAD

Disease

Immune system diseases;KEGG DISEASE

Disease

Primary immunodeficiency;KEGG DISEASE

External Links

Links to Entrez Gene

7852

Links to all GeneRIF Items

7852

Links to iHOP

7852

Sequence Information

Nucleotide Sequence

>7852 : length: 1071
atgtccattcctttgcctcttttgcagatatacacttcagataactacaccgaggaaatg
ggctcaggggactatgactccatgaaggaaccctgtttccgtgaagaaaatgctaatttc
aataaaatcttcctgcccaccatctactccatcatcttcttaactggcattgtgggcaat
ggattggtcatcctggtcatgggttaccagaagaaactgagaagcatgacggacaagtac
aggctgcacctgtcagtggccgacctcctctttgtcatcacgcttcccttctgggcagtt
gatgccgtggcaaactggtactttgggaacttcctatgcaaggcagtccatgtcatctac
acagtcaacctctacagcagtgtcctcatcctggccttcatcagtctggaccgctacctg
gccatcgtccacgccaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtc
tatgttggcgtctggatccctgccctcctgctgactattcccgacttcatctttgccaac
gtcagtgaggcagatgacagatatatctgtgaccgcttctaccccaatgacttgtgggtg
gttgtgttccagtttcagcacatcatggttggccttatcctgcctggtattgtcatcctg
tcctgctattgcattatcatctccaagctgtcacactccaagggccaccagaagcgcaag
gccctcaagaccacagtcatcctcatcctggctttcttcgcctgttggctgccttactac
attgggatcagcatcgactccttcatcctcctggaaatcatcaagcaagggtgtgagttt
gagaacactgtgcacaagtggatttccatcaccgaggccctagctttcttccactgttgt
ctgaaccccatcctctatgctttccttggagccaaatttaaaacctctgcccagcacgca
ctcacctctgtgagcagagggtccagcctcaagatcctctccaaaggaaagcgaggtgga
cattcatctgtttccactgagtctgagtcttcaagttttcactccagctaa

Protein Sequence

>7852 : length: 356
MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGN
GLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIY
TVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFAN
VSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRK
ALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCC
LNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS



')