Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7791

Name

ZYX

Synonym

ESP-2|HED-2;zyxin;ZYX;zyxin

Definition

zyxin-2

Position

7q32

Gene Type

protein-coding

Pathways and Diseases

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

External Links

Links to Entrez Gene

7791

Links to all GeneRIF Items

7791

Links to iHOP

7791

Sequence Information

Nucleotide Sequence

>7791 : length: 1719
atggcggccccccgcccgtctcccgcgatctccgtttcggtctcggctccggctttttac
gccccgcagaagaagttcggccctgtggtggccccaaagcccaaagtgaatcccttccgg
cccggggacagcgagcctcccccggcacccggggcccagcgcgcacagatgggccgggtg
ggcgagattcccccgccgcccccggaagactttcccctgcctccacctccccttgctggg
gatggcgacgatgcagagggtgctctgggaggtgccttcccgccgccccctcccccgatc
gaggaatcatttccccctgcgcctctggaggaggagatcttcccttccccgccgcctcct
ccggaggaggagggagggcctgaggcccccataccgcccccaccacagcccagggagaag
gtgagcagtattgatttggagatcgactctctgtcctcactgctggatgacatgaccaag
aatgatcctttcaaagcccgggtgtcatctggatatgtgcccccaccagtggccactcca
ttcagttccaagtccagtaccaagcctgcagccgggggcacagcacccctgcctccttgg
aagtccccttccagctcccagcctctgccccaggttccggctccggctcagagccagaca
cagttccatgttcagccccagccccagcccaagcctcaggtccaactccatgtccagtcc
cagacccagcctgtgtctttggctaacacccagccccgagggcccccagcctcatctccg
gctccagcccctaagttttctccagtgactcctaagtttactcctgtggcttccaagttc
agtcctggagccccaggtggatctgggtcacaaccaaatcaaaaattggggcaccccgaa
gctctttctgctggcacaggctcccctcaacctcccagcttcacctatgcccagcagagg
gagaagccccgagtgcaggagaagcagcaccccgtgcccccaccggctcagaaccaaaac
caggtgcgctcccctggggccccagggcccctgactctgaaggaggtggaggagctggag
cagctgacccagcagctaatgcaggacatggagcatcctcagaggcagaatgtggctgtc
aacgaactctgcggccgatgccatcaacccctggcccgggcgcagccagccgtccgcgct
ctagggcagctgttccacatcgcctgcttcacctgccaccagtgtgcgcagcagctccag
ggccagcagttctacagtctggagggggcgccgtactgcgagggctgttacactgacacc
ctggagaagtgtaacacctgcggggagcccatcactgaccgcatgctgagggccacgggc
aaggcctatcacccgcactgcttcacctgtgtggtctgcgcccgccccctggagggcacc
tccttcatcgtggaccaggccaaccggccccactgtgtccccgactaccacaagcagtac
gccccgaggtgctccgtctgctctgagcccatcatgcctgagcctggccgagatgagact
gtgcgagtggtcgccctggacaagaacttccacatgaagtgttacaagtgtgaggactgc
gggaagcccctgtcgattgaggcagatgacaatggctgcttccccctggacggtcacgtg
ctctgtcggaagtgccacactgctagagcccagacctga

Protein Sequence

>7791 : length: 572
MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRV
GEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPP
PEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATP
FSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQS
QTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE
ALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELE
QLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ
GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGT
SFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDC
GKPLSIEADDNGCFPLDGHVLCRKCHTARAQT



')