Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7764

Name

ZNF217

Synonym

ZABC1;zinc finger protein 217;ZNF217;zinc finger protein 217

Definition

-

Position

20q13.2

Gene Type

protein-coding

External Links

Links to Entrez Gene

7764

Links to all GeneRIF Items

7764

Links to iHOP

7764

Sequence Information

Nucleotide Sequence

>7764 : length: 3147
atgcaatcgaaagtgacaggaaacatgccaactcaatccctcttaatgtacatggatggg
ccagaagtgattggcagctctcttggcagtccgatggagatggaggatgccttgtcaatg
aaagggaccgctgttgttccattccgagctacacaagaaaaaaatgtcatccaaatcgag
gggtatatgcccttggattgcatgttctgcagccagaccttcacacattcagaagacctt
aataaacatgtcttaatgcaacaccggcctaccctctgtgaaccagcagttcttcgggtt
gaagcagagtatctcagtccgcttgataaaagtcaagtgcgaacagaacctcccaaggaa
aagaattgcaaggaaaatgaatttagctgtgaggtatgtgggcagacatttagagtcgct
tttgatgttgagatccacatgagaacacacaaagattctttcacttacgggtgtaacatg
tgcggaagaagattcaaggagccttggtttcttaaaaatcacatgcggacacataatggc
aaatcgggggccagaagcaaactgcagcaaggcttggagagtagtccagcaacgatcaac
gaggtcgtccaggtgcacgcggccgagagcatctcctctccttacaaaatctgcatggtt
tgtggcttcctatttccaaataaagaaagtctaattgagcaccgcaaggtgcacaccaaa
aaaactgctttcggtaccagcagcgcgcagacagactctccacaaggaggaatgccgtcc
tcgagggaggacttcctgcagttgttcaacttgagaccaaaatctcaccctgaaacgggg
aagaagcctgtcagatgcatccctcagctcgatccgttcaccaccttccaggcttggcag
ctggctaccaaaggaaaagttgccatttgccaagaagtgaaggaatcggggcaagaaggg
agcaccgacaacgacgattcgagttccgagaaggagcttggagaaacaaataagggcagt
tgtgcaggcctctcgcaagagaaagagaagtgcaaacactcccacggcgaagcgccctcc
gtggacgcggatcccaagttacccagtagcaaggagaagcccactcactgctccgagtgc
ggcaaagctttcagaacctaccaccagctggtcttgcactccagggtccacaagaaggac
cggagggccggcgcggagtcgcccaccatgtctgtggacgggaggcagccggggacgtgt
tctcctgacctcgccgcccctctggatgaaaatggagccgtggatcgaggggaaggtggt
tctgaagacggatctgaggatgggcttcccgaaggaatccatctggataaaaatgatgat
ggaggaaaaataaaacatcttacatcttcaagagagtgtagttattgtggaaagtttttc
cgttcaaattattacctcaatattcatctcagaacgcatacaggtgaaaaaccatacaaa
tgtgaattttgtgaatatgctgcagcccagaagacatctctgaggtatcacttggagaga
catcacaaggaaaaacaaaccgatgttgctgctgaagtcaagaacgatggtaaaaatcag
gacactgaagatgcactattaaccgctgacagtgcgcaaaccaaaaatttgaaaagattt
tttgatggtgccaaagatgttacaggcagtccacctgcaaagcagcttaaggagatgcct
tctgtttttcagaatgttctgggcagcgctgtcctctcaccagcacacaaagatactcag
gatttccataaaaatgcagctgatgacagtgctgataaagtgaataaaaaccctacccct
gcttacctggacctgttaaaaaagagatcagcagttgaaactcaggcaaataacctcatc
tgtagaaccaaggcggatgttactcctcctccggatggcagtaccacccataaccttgaa
gttagccccaaagagaagcaaacggagaccgcagctgactgcagatacaggccaagtgtg
gattgtcacgaaaaacctttaaatttatccgtgggggctcttcacaattgcccggcaatt
tctttgagtaaaagtttgattccaagtatcacctgtccattttgtaccttcaagacattt
tatccagaagttttaatgatgcaccagagactggagcataaatacaatcctgacgttcat
aaaaactgtcgaaacaagtccttgcttagaagtcgacgtaccggatgcccgccagcgttg
ctgggaaaagatgtgcctcccctctctagtttctgtaaacccaagcccaagtctgctttc
ccggcgcagtccaaatccctgccatctgcgaaggggaagcagagccctcctgggccaggc
aaggcccctctgacttcagggatagactctagcactttagccccaagtaacctgaagtcc
cacagaccacagcagaatgtgggggtccaaggggccgccaccaggcaacagcaatctgag
atgtttcctaaaaccagtgtttcccctgcaccggataagacaaaaagacccgagacaaaa
ttgaaacctcttccagtagctccttctcagcccaccctcggcagcagtaacatcaatggt
tccatcgactaccccgccaagaacgacagcccgtgggcacctccgggaagagactatttc
tgtaatcggagtgccagcaatactgcagcagaatttggtgagccccttccaaaaagactg
aagtccagcgtggttgcccttgacgttgaccagcccggggccaattacagaagaggctat
gaccttcccaagtaccatatggtcagaggcatcacatcactgttaccgcaggactgtgtg
tatccgtcgcaggcgctgcctcccaaaccaaggttcctgagctccagcgaggtcgattct
ccaaatgtgctgactgttcagaagccctatggtggctccgggccactttacacttgtgtg
cctgctggtagtccagcatccagctcgacgttagaaggaaaaaggcctgtgtcatatcaa
cacttatctaacagcatggcacaaaagagaaactatgagaattttattgggaatgcacat
tatcgaccaaatgacaaaaaaacttga

Protein Sequence

>7764 : length: 1048
MQSKVTGNMPTQSLLMYMDGPEVIGSSLGSPMEMEDALSMKGTAVVPFRATQEKNVIQIE
GYMPLDCMFCSQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKE
KNCKENEFSCEVCGQTFRVAFDVEIHMRTHKDSFTYGCNMCGRRFKEPWFLKNHMRTHNG
KSGARSKLQQGLESSPATINEVVQVHAAESISSPYKICMVCGFLFPNKESLIEHRKVHTK
KTAFGTSSAQTDSPQGGMPSSREDFLQLFNLRPKSHPETGKKPVRCIPQLDPFTTFQAWQ
LATKGKVAICQEVKESGQEGSTDNDDSSSEKELGETNKGSCAGLSQEKEKCKHSHGEAPS
VDADPKLPSSKEKPTHCSECGKAFRTYHQLVLHSRVHKKDRRAGAESPTMSVDGRQPGTC
SPDLAAPLDENGAVDRGEGGSEDGSEDGLPEGIHLDKNDDGGKIKHLTSSRECSYCGKFF
RSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHHKEKQTDVAAEVKNDGKNQ
DTEDALLTADSAQTKNLKRFFDGAKDVTGSPPAKQLKEMPSVFQNVLGSAVLSPAHKDTQ
DFHKNAADDSADKVNKNPTPAYLDLLKKRSAVETQANNLICRTKADVTPPPDGSTTHNLE
VSPKEKQTETAADCRYRPSVDCHEKPLNLSVGALHNCPAISLSKSLIPSITCPFCTFKTF
YPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAF
PAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSE
MFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYF
CNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCV
YPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQ
HLSNSMAQKRNYENFIGNAHYRPNDKKT



')