Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7534

Name

YWHAZ

Synonym

14-3-3-zeta|KCIP-1|YWHAD;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide;YWHAZ;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide

Definition

14-3-3 delta|14-3-3 protein zeta/delta|14-3-3 protein/cytosolic phospholipase A2|14-3-3 zeta|phospholipase A2|protein kinase C inhibitor protein 1|protein kinase C inhibitor protein-1|tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein,

Position

8q23.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

p38 signaling mediated by MAPKAP kinases;PID Curated;200135

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Hemostasis;Reactome;REACT:604

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

IGF1 pathway;PID Curated;200084

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Disease

Attention deficit hyperactivity disorder and conduct disorder;GAD

Disease

PSYCH;GAD

Disease

Attention deficit hyperactivity disorder and conduct disorder;NHGRI

External Links

Links to Entrez Gene

7534

Links to all GeneRIF Items

7534

Links to iHOP

7534

Sequence Information

Nucleotide Sequence

>7534 : length: 738
atggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaaggg
attgtcgatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgag
attctgaactccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaatta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

Protein Sequence

>7534 : length: 245
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN



')