Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7490

Name

WT1

Synonym

AWT1|EWS-WT1|GUD|NPHS4|WAGR|WIT-2|WT33;Wilms tumor 1;WT1;Wilms tumor 1

Definition

Wilms tumor protein|amino-terminal domain of EWS|last three zinc fingers of the DNA-binding domain of WT1

Position

11p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

chaperones modulate interferon signaling pathway;PID BioCarta;100016

Pathway

overview of telomerase protein component gene htert transcriptional regulation;PID BioCarta;100019

Pathway

Regulation of Telomerase;PID Curated;200072

Disease

Denys-Drash syndrome;GAD

Disease

Nephrotic syndrome, typ 4;OMIM

Disease

Alzheimer's disease;GAD

Disease

Cancer;FunDO

Disease

WAGR Syndrome;GAD

Disease

DEVELOPMENTAL;GAD

Disease

glomerulosclerosis, focal;GAD

Disease

Pleural effusion, Malignant;FunDO

Disease

Meacham syndrome;OMIM

Disease

Frasier syndrome;OMIM

Disease

Wilm's tumor;GAD

Disease

Aplastic anemia;FunDO

Disease

Yersinia infection;FunDO

Disease

Cirrhosis;FunDO

Disease

Alzheimer's disease;FunDO

Disease

wilms' tumor and congenital male genitourinary malformation;GAD

Disease

Nephritis;FunDO

Disease

Proteinuria;FunDO

Disease

Wilms tumor, type 1;OMIM

Disease

CANCER;GAD

Disease

hypospadias;GAD

Disease

Endometriosis;FunDO

Disease

NEUROLOGICAL;GAD

Disease

abnormal urogenital development;GAD

Disease

Hyperparathyroidism;FunDO

Disease

nephrotic syndrome;GAD

Disease

Urogenital abnormalities;FunDO

Disease

Denys-Drash syndrome;OMIM

Disease

RENAL;GAD

External Links

Links to Entrez Gene

7490

Links to all GeneRIF Items

7490

Links to iHOP

7490

Sequence Information

Nucleotide Sequence

>7490 : length: 1494
ctgcaggacccggcttccacgtgtgtcccggagccggcgtctcagcacacgctccgctcc
gggcctgggtgcctacagcagccagagcagcagggagtccgggacccgggcggcatctgg
gccaagttaggcgccgccgaggccagcgctgaacgtctccagggccggaggagccgcggg
gcgtccgggtctgagccgcagcaaatgggctccgacgtgcgggacctgaacgcgctgctg
cccgccgtcccctccctgggtggcggcggcggctgtgccctgcctgtgagcggcgcggcg
cagtgggcgccggtgctggactttgcgcccccgggcgcttcggcttacgggtcgttgggc
ggccccgcgccgccaccggctccgccgccacccccgccgccgccgcctcactccttcatc
aaacaggagccgagctggggcggcgcggagccgcacgaggagcagtgcctgagcgccttc
actgtccacttttccggccagttcactggcacagccggagcctgtcgctacgggcccttc
ggtcctcctccgcccagccaggcgtcatccggccaggccaggatgtttcctaacgcgccc
tacctgcccagctgcctcgagagccagcccgctattcgcaatcagggttacagcacggtc
accttcgacgggacgcccagctacggtcacacgccctcgcaccatgcggcgcagttcccc
aaccactcattcaagcatgaggatcccatgggccagcagggctcgctgggtgagcagcag
tactcggtgccgcccccggtctatggctgccacacccccaccgacagctgcaccggcagc
caggctttgctgctgaggacgccctacagcagtgacaatttataccaaatgacatcccag
cttgaatgcatgacctggaatcagatgaacttaggagccaccttaaagggccacagcaca
gggtacgagagcgataaccacacaacgcccatcctctgcggagcccaatacagaatacac
acgcacggtgtcttcagaggcattcaggatgtgcgacgtgtgcctggagtagccccgact
cttgtacggtcggcatctgagaccagtgagaaacgccccttcatgtgtgcttacccaggc
tgcaataagagatattttaagctgtcccacttacagatgcacagcaggaagcacactggt
gagaaaccataccagtgtgacttcaaggactgtgaacgaaggttttctcgttcagaccag
ctcaaaagacaccaaaggagacatacaggtgtgaaaccattccagtgtaaaacttgtcag
cgaaagttctcccggtccgaccacctgaagacccacaccaggactcatacaggtgaaaag
cccttcagctgtcggtggccaagttgtcagaaaaagtttgcccggtcagatgaattagtc
cgccatcacaacatgcatcagagaaacatgaccaaactccagctggcgctttga

Protein Sequence

>7490 : length: 497
MQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRG
ASGSEPQQMGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLG
GPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPF
GPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFP
NHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQ
LECMTWNQMNLGATLKGHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPT
LVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQ
LKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELV
RHHNMHQRNMTKLQLAL



')