Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7475

Name

WNT6

Synonym

-;wingless-type MMTV integration site family, member 6;WNT6;wingless-type MMTV integration site family, member 6

Definition

protein Wnt-6

Position

2q35

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

External Links

Links to Entrez Gene

7475

Links to all GeneRIF Items

7475

Links to iHOP

7475

Sequence Information

Nucleotide Sequence

>7475 : length: 1098
atgctgccgcccttaccctcccgcctcgggctgctgctgctgctgctcctgtgcccggcg
cacgtcggcggactgtggtgggctgtgggcagccccttggttatggaccctaccagcatc
tgcaggaaggcacggcggctggccgggcggcaggccgagttgtgccaggctgagccggaa
gtggtggcagagctagctcggggcgcccggctcggggtgcgagagtgccagttccagttc
cgcttccgccgctggaattgctccagccacagcaaggcctttggacgcatcctgcaacag
gacattcgggagacggccttcgtgttcgccatcactgcggccggcgccagccacgccgtc
acgcaggcctgttctatgggcgagctgctgcagtgcggctgccaggcgccccgcgggcgg
gcccctccccggccctccggcctgcccggcacccccggaccccctggccccgcgggctcc
ccggaaggcagcgccgcctgggagtggggaggctgcggcgacgacgtggacttcggggac
gagaagtcgaggctctttatggacgcgcggcacaagcggggacgcggagacatccgcgcg
ttggtgcaactgcacaacaacgaggcgggcaggctggccgtgcggagccacacgcgcacc
gagtgcaaatgccacgggctgtcgggatcatgcgcgctgcgcacctgctggcagaagctg
cctccatttcgcgaggtgggcgcgcggctgctggagcgcttccacggcgcctcacgcgtc
atgggcaccaacgacggcaaggccctgctgcccgccgtccgcacgctcaagccgccgggc
cgagcggacctcctctacgccgccgattcgcccgacttctgcgcccccaaccgacgcacc
ggctcccccggcacgcgcggtcgcgcctgcaatagcagcgccccggacctcagcggctgc
gacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgaagagaactgc
ctgtgccgcttccactggtgctgcgtagtacagtgccaccgctgccgtgtgcgcaaggag
ctcagcctctgcctgtga

Protein Sequence

>7475 : length: 365
MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL



')