Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7474

Name

WNT5A

Synonym

hWNT5A;wingless-type MMTV integration site family, member 5A;WNT5A;wingless-type MMTV integration site family, member 5A

Definition

WNT-5A protein|protein Wnt-5a

Position

3p21-p14

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Wnt signaling network;PID Curated;200055

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Disease

Systemic infection;FunDO

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

7474

Links to all GeneRIF Items

7474

Links to iHOP

7474

Sequence Information

Nucleotide Sequence

>7474 : length: 1143
atgaagaagtccattggaatattaagcccaggagttgctttggggatggctggaagtgca
atgtcttccaagttcttcctagtggctttggccatatttttctccttcgcccaggttgta
attgaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatattataggagcacagcctctctgcagccaactggcaggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacatcggagaaggcgcgaagacaggc
atcaaagaatgccagtatcaattccgacatcgaaggtggaactgcagcactgtggataac
acctctgtttttggcagggtgatgcagataggcagccgcgagacggccttcacatacgcg
gtgagcgcagcaggggtggtgaacgccatgagccgggcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgccccaaggacctgccgcgggactggctctggggc
ggctgcggcgacaacatcgactatggctaccgctttgccaaggagttcgtggacgcccgc
gagcgggagcgcatccacgccaagggctcctacgagagtgctcgcatcctcatgaacctg
cacaacaacgaggccggccgcaggacggtgtacaacctggctgatgtggcctgcaagtgc
catggggtgtccggctcatgtagcctgaagacatgctggctgcagctggcagacttccgc
aaggtgggtgatgccctgaaggagaagtacgacagcgcggcggccatgcggctcaacagc
cggggcaagttggtacaggtcaacagccgcttcaactcgcccaccacacaagacctggtc
tacatcgaccccagccctgactactgcgtgcgcaatgagagcaccggctcgctgggcacg
cagggccgcctgtgcaacaagacgtcggagggcatggatggctgcgagctcatgtgctgc
ggccgtggctacgaccagttcaagaccgtgcagacggagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacggagatcgtggaccagtttgtgtgcaag
tag

Protein Sequence

>7474 : length: 380
MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK



')