Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7471

Name

WNT1

Synonym

INT1;wingless-type MMTV integration site family, member 1;WNT1;wingless-type MMTV integration site family, member 1

Definition

proto-oncogene Int-1 homolog|proto-oncogene Wnt-1|wingless-type MMTV integration site family, member 1 (oncogene INT1)

Position

12q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Angiogenesis;PANTHER;P00005

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Wnt signaling network;PID Curated;200055

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

segmentation clock;PID BioCarta;100146

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Disease

Cancer;FunDO

Disease

Systemic scleroderma;FunDO

Disease

Neurodegenerative disorder;FunDO

External Links

Links to Entrez Gene

7471

Links to all GeneRIF Items

7471

Links to iHOP

7471

Sequence Information

Nucleotide Sequence

>7471 : length: 1113
atggggctctgggcgctgttgcctggctgggtttctgctacgctgctgctggcgctggcc
gctctgcccgcagccctggctgccaacagcagtggccgatggtggggtattgtgaacgta
gcctcctccacgaacctgcttacagactccaagagtctgcaactggtactcgagcccagt
ctgcagctgttgagccgcaaacagcggcgtctgatacgccaaaatccggggatcctgcac
agcgtgagtggggggctgcagagtgccgtgcgcgagtgcaagtggcagttccggaatcgc
cgctggaactgtcccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgagaaacggcgtttatcttcgctatcacctccgccggggtcacccattcggtggcg
cgctcctgctcagaaggttccatcgaatcctgcacgtgtgactaccggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacattgacttcggccgcctcttc
ggccgggagttcgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcaggccgtacgaccgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcatgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgatgtgctgcgcgaccgcttcgacggcgcctcgcgcgtcctgtacggcaac
cgcggcagcaaccgcgcttcgcgggcggagctgctgcgcctggagccggaagacccggcc
cacaaaccgccctccccccacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagcggacgcctgggcacagcaggcacggcagggcgcgcctgtaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgcggcaggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

Protein Sequence

>7471 : length: 370
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL



')