Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7448

Name

VTN

Synonym

V75|VN|VNT;vitronectin;VTN;vitronectin

Definition

S-protein|complement S-protein|epibolin|serum spreading factor|serum-spreading factor|somatomedin B

Position

17q11

Gene Type

protein-coding

Pathways and Diseases

Pathway

FOXA1 transcription factor network;PID Curated;200194

Pathway

Integrin cell surface interactions;PID Reactome;500004

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

amb2 Integrin signaling;PID Curated;200108

Disease

Breast cancer;FunDO

Disease

Ovarian cancer;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

7448

Links to all GeneRIF Items

7448

Links to iHOP

7448

Sequence Information

Nucleotide Sequence

>7448 : length: 1437
atggcacccctgagaccccttctcatactggccctgctggcatgggttgctctggctgac
caagagtcatgcaagggccgctgcactgagggcttcaacgtggacaagaagtgccagtgt
gacgagctctgctcttactaccagagctgctgcacagactatacggctgagtgcaagccc
caagtgactcgcggggatgtgttcactatgccggaggatgagtacacggtctatgacgat
ggcgaggagaaaaacaatgccactgtccatgaacaggtggggggcccctccctgacctct
gacctccaggcccagtccaaagggaatcctgagcagacacctgttctgaaacctgaggaa
gaggcccctgcgcctgaggtgggcgcctctaagcctgaggggatagactcaaggcctgag
acccttcatccagggagacctcagcccccagcagaggaggagctgtgcagtgggaagccc
ttcgacgccttcaccgacctcaagaacggttccctctttgccttccgagggcagtactgc
tatgaactggacgaaaaggcagtgaggcctgggtaccccaagctcatccgagatgtctgg
ggcatcgagggccccatcgatgccgccttcacccgcatcaactgtcaggggaagacctac
ctcttcaagggtagtcagtactggcgctttgaggatggtgtcctggaccctgattacccc
cgaaatatctctgacggcttcgatggcatcccggacaacgtggatgcagccttggccctc
cctgcccatagctacagtggccgggagcgggtctacttcttcaaggggaaacagtactgg
gagtaccagttccagcaccagcccagtcaggaggagtgtgaaggcagctccctgtcggct
gtgtttgaacactttgccatgatgcagcgggacagctgggaggacatcttcgagcttctc
ttctggggcagaacctctgctggtaccagacagccccagttcattagccgggactggcac
ggtgtgccagggcaagtggacgcagccatggctggccgcatctacatctcaggcatggca
ccccgcccctccttggccaagaaacaaaggtttaggcatcgcaaccgcaaaggctaccgt
tcacaacgaggccacagccgtggccgcaaccagaactcccgccggccatcccgcgccacg
tggctgtccttgttctccagtgaggagagcaacttgggagccaacaactatgatgactac
aggatggactggcttgtgcctgccacctgtgaacccatccagagtgtcttcttcttctct
ggagacaagtactaccgagtcaatcttcgcacacggcgagtggacactgtggaccctccc
tacccacgctccatcgctcagtactggctgggctgcccagctcctggccatctgtag

Protein Sequence

>7448 : length: 478
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL



')