Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7447

Name

VSNL1

Synonym

HLP3|HPCAL3|HUVISL1|VILIP|VILIP-1;visinin-like 1;VSNL1;visinin-like 1

Definition

VLP-1|hippocalcin-like protein 3|visinin-like protein 1

Position

2p24.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

7447

Links to all GeneRIF Items

7447

Links to iHOP

7447

Sequence Information

Nucleotide Sequence

>7447 : length: 576
atggggaagcagaatagcaaactggcccctgaagtgatggaggacctggtgaagagcaca
gagtttaatgagcatgaactcaagcagtggtacaaaggatttctcaaggactgtccaagt
gggaggctaaatctcgaggaatttcagcagctctatgtgaagttctttccttatggagac
gcctccaagtttgcccagcatgccttccgaaccttcgacaagaatggggacggcaccatt
gacttccgagagttcatctgcgctctgtccatcacctccaggggcagctttgagcagaag
ctgaactgggccttcaatatgtatgacctggatggtgatggcaagatcacccgagtggag
atgctggagatcatcgaggctatctacaaaatggtaggcactgtgatcatgatgaaaatg
aatgaggatggcctgacgcctgagcagcgagtagacaagattttcagcaagatggataag
aacaaagatgaccagattacactggatgaattcaaagaagctgcaaagagcgacccttcc
attgtattacttctgcagtgcgacatccagaaatga

Protein Sequence

>7447 : length: 191
MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGD
ASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVE
MLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPS
IVLLLQCDIQK



')