Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7430

Name

EZR

Synonym

CVIL|CVL|VIL2;ezrin;EZR;ezrin

Definition

cytovillin 2|p81|villin 2 (ezrin)|villin-2

Position

6q25.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

LKB1 signaling events;PID Curated;200061

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Recycling pathway of L1;PID Reactome;500098

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

FAS (CD95) signaling pathway;PID Curated;200067

Pathway

mcalpain and friends in cell motility;PID BioCarta;100111

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Netrin-1 signaling;PID Reactome;500088

Pathway

Gastric acid secretion;KEGG PATHWAY;hsa04971

Pathway

ucalpain and friends in cell spread;PID BioCarta;100008

Pathway

cystic fibrosis transmembrane conductance regulator (cftr) and beta 2 adrenergic receptor (b2ar) pathway;PID BioCarta;100205

Disease

Diabetes mellitus;FunDO

Disease

Bone disease;FunDO

Disease

Infection;FunDO

Disease

Congenital abnormality;FunDO

Disease

Cancer;FunDO

Disease

Endometriosis;FunDO

External Links

Links to Entrez Gene

7430

Links to all GeneRIF Items

7430

Links to iHOP

7430

Sequence Information

Nucleotide Sequence

>7430 : length: 1761
atgccgaaaccaatcaatgtccgagttaccaccatggatgcagagctggagtttgcaatc
cagccaaatacaactggaaaacagctttttgatcaggtggtaaagactatcggcctccgg
gaagtgtggtactttggcctccactatgtggataataaaggatttcctacctggctgaag
ctggataagaaggtgtctgcccaggaggtcaggaaggagaatcccctccagttcaagttc
cgggccaagttctaccctgaagatgtggctgaggagctcatccaggacatcacccagaaa
cttttcttcctccaagtgaaggaaggaatccttagcgatgagatctactgcccccctgag
actgccgtgctcttggggtcctacgctgtgcaggccaagtttggggactacaacaaagaa
gtgcacaagtctgggtacctcagctctgagcggctgatccctcaaagagtgatggaccag
cacaaacttaccagggaccagtgggaggaccggatccaggtgtggcatgcggaacaccgt
gggatgctcaaagataatgctatgttggaatacctgaagattgctcaggacctggaaatg
tatggaatcaactatttcgagataaaaaacaagaaaggaacagacctttggcttggagtt
gatgcccttggactgaatatttatgagaaagatgataagttaaccccaaagattggcttt
ccttggagtgaaatcaggaacatctctttcaatgacaaaaagtttgtcattaaacccatc
gacaagaaggcacctgactttgtgttttatgccccacgtctgagaatcaacaagcggatc
ctgcagctctgcatgggcaaccatgagttgtatatgcgccgcaggaagcctgacaccatc
gaggtgcagcagatgaaggcccaggcccgggaggagaagcatcagaagcagctggagcgg
caacagctggaaacagagaagaaaaggagagaaaccgtggagagagagaaagagcagatg
atgcgcgagaaggaggagttgatgctgcggctgcaggactatgaggagaagacaaagaag
gcagagagagagctctcggagcagattcagagggccctgcagctggaggaggagaggaag
cgggcacaggaggaggccgagcgcctagaggctgaccgtatggctgcactgcgggctaag
gaggagctggagagacaggcggtggatcagataaagagccaggagcagctggctgcggag
cttgcagaatacactgccaagattgccctcctggaagaggcgcggaggcgcaaggaggat
gaagttgaagagtggcagcacagggccaaagaagcccaggatgacctggtgaagaccaag
gaggagctgcacctggtgatgacagcacccccgcccccaccaccccccgtgtacgagccg
gtgagctaccatgtccaggagagcttgcaggatgagggcgcagagcccacgggctacagc
gcggagctgtctagtgagggcatccgggatgaccgcaatgaggagaagcgcatcactgag
gcagagaagaacgagcgtgtgcagcggcagctgctgacgctgagcagcgagctgtcccag
gcccgagatgagaataagaggacccacaatgacatcatccacaacgagaacatgaggcaa
ggccgggacaagtacaagacgctgcggcagatccggcagggcaacaccaagcagcgcatc
gacgagttcgaggccctgtaa

Protein Sequence

>7430 : length: 586
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK
AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL



')