Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7422

Name

VEGFA

Synonym

MVCD1|VEGF|VPF;vascular endothelial growth factor A;VEGFA;vascular endothelial growth factor A

Definition

vascular permeability factor

Position

6p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Neurophilin interactions with VEGF and VEGFR;PID Reactome;500650

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

S1P1 pathway;PID Curated;200071

Pathway

HIF-2-alpha transcription factor network;PID Curated;200030

Pathway

Glypican 1 network;PID Curated;200021

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

hypoxia-inducible factor in the cardivascular system;PID BioCarta;100145

Pathway

Angiogenesis;PANTHER;P00005

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

actions of nitric oxide in the heart;PID BioCarta;100094

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Signaling by VEGF;Reactome;REACT:12529

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Disease

Microvascular complications of diabetes 1;OMIM

Disease

Cancer;FunDO

Disease

longevity;GAD

Disease

IMMUNE;GAD

Disease

endometriosis;GAD

Disease

kawasaki disease;GAD

Disease

Pre-Eclampsia;GAD

Disease

Neovascularization, Pathologic;GAD

Disease

Malaria;FunDO

Disease

diabetes, type 1 diabetic nephropathy;GAD

Disease

sarcoidosis;GAD

Disease

diabetes, type 2 retinopathy, diabetic;GAD

Disease

Macular Degeneration;GAD

Disease

myocardial infarct;GAD

Disease

Atherosclerosis;FunDO

Disease

Polyneuropathy;FunDO

Disease

Waist-hip ratio;NHGRI

Disease

pregnancy loss, recurrent;GAD

Disease

urinary calculus;GAD

Disease

kidney cancer;GAD

Disease

Stomach Neoplasms;GAD

Disease

vascular endothelial growth factor levels;GAD

Disease

nephropathy, IgA;GAD

Disease

oral cancer;GAD

Disease

Mucocutaneous lymph node syndrome;FunDO

Disease

atherosclerosis, coronary;GAD

Disease

prostate cancer;GAD

Disease

Systemic infection;FunDO

Disease

diabetes, type 1;GAD

Disease

vascular endothelial growth factor;GAD

Disease

Heart Septal Defects, Ventricular;GAD

Disease

cutaneous malignant melanoma;GAD

Disease

acute renal allograft rejection;GAD

Disease

CANCER;GAD

Disease

diabetic nephropathy;GAD

Disease

Carcinoma, Squamous Cell;GAD

Disease

Pterygium;GAD

Disease

benzene haematotoxicity;GAD

Disease

Type 2 diabetes;NHGRI

Disease

Macular degeneration;FunDO

Disease

AGING;GAD

Disease

ALS/amyotrophic lateral sclerosis;GAD

Disease

hemodialysis;GAD

Disease

type 2 diabetes;GAD

Disease

Henoch-Schonlein purpura;GAD

Disease

psoriasis;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

METABOLIC;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Diabetic Retinopathy in Type 2 Diabetes;GAD

Disease

rheumatoid arthritis;GAD

Disease

retinopathy, diabetic;GAD

Disease

colorectal cancer;GAD

Disease

retinopathy;GAD

Disease

Capillaries disease;FunDO

Disease

diabetes, type 2;GAD

Disease

18F-fluorodeoxyglucose uptake;GAD

Disease

macular edema;GAD

Disease

CARDIOVASCULAR;GAD

Disease

renal disease, end stage vascular endothelial growth factor;GAD

Disease

Chronic obstructive airway disease;FunDO

Disease

REPRODUCTION;GAD

Disease

Cancers;KEGG DISEASE

Disease

breast cancer;GAD

Disease

Leiomyoma;GAD

Disease

Obesity;FunDO

Disease

coronary artery bypass;GAD

Disease

ovarian cancer;GAD

Disease

stomach cancer;GAD

Disease

Retinopathy of Prematurity;GAD

Disease

Pre-Eclampsia;FunDO

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

preterm delivery;GAD

Disease

Alzheimer's disease;GAD

Disease

stomach cancer vascular endothelial growth factor levels;GAD

Disease

Chronic kidney disease;NHGRI

Disease

bladder cancer;GAD

Disease

Leukoencephalopathy;FunDO

Disease

Mouth Neoplasms;GAD

Disease

heart anomalies, congenital;GAD

Disease

SIDS/sudden infant death syndrome;GAD

Disease

lung cancer;GAD

Disease

VISION;GAD

Disease

nephropathy in other diseases;GAD

Disease

Peptic ulcer;FunDO

Disease

Heart Failure;GAD

Disease

Ventricular Septal Defects;GAD

Disease

Femur Head Necrosis;GAD

Disease

Uterine Neoplasms;GAD

Disease

Diabetes mellitus;FunDO

Disease

respiratory distress syndrome;GAD

Disease

heart transplant complications;GAD

Disease

nephritis, Henoch-Schonlein;GAD

Disease

Familial Mediterranean fever;FunDO

Disease

Myocardial Infarction;GAD

Disease

Kidney failure;FunDO

Disease

giant cell arteritis;GAD

Disease

NEUROLOGICAL;GAD

Disease

spontaneous preterm delivery.;GAD

Disease

RENAL;GAD

External Links

Links to Entrez Gene

7422

Links to all GeneRIF Items

7422

Links to iHOP

7422

Sequence Information

Nucleotide Sequence

>7422 : length: 1239
ctgacggacagacagacagacaccgcccccagccccagctaccacctcctccccggccgg
cggcggacagtggacgcggcggcgagccgcgggcaggggccggagcccgcgcccggaggc
ggggtggagggggtcggggctcgcggcgtcgcactgaaacttttcgtccaacttctgggc
tgttctcgcttcggaggagccgtggtccgcgcgggggaagccgagccgagcggagccgcg
agaagtgctagctcgggccgggaggagccgcagccggaggagggggaggaggaagaagag
aaggaagaggagagggggccgcagtggcgactcggcgctcggaagccgggctcatggacg
ggtgaggcggcggtgtgcgcagacagtgctccagccgcgcgcgctccccaggccctggcc
cgggcctcgggccggggaggaagagtagctcgccgaggcgccgaggagagcgggccgccc
cacagcccgagccggagagggagcgcgagccgcgccggccccggtcgggcctccgaaacc
atgaactttctgctgtcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgcgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgtgtacgttggtgcccgctgctgtctaatgccctggagcctccctggc
ccccatccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcag
acgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagtta
aacgaacgtacttgcagatgtgacaagccgaggcggtga

Protein Sequence

>7422 : length: 412
MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLG
CSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWT
GEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASET
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR



')