Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7421

Name

VDR

Synonym

NR1I1;vitamin D (1,25- dihydroxyvitamin D3) receptor;VDR;vitamin D (1,25- dihydroxyvitamin D3) receptor

Definition

1,25-dihydroxyvitamin D3 receptor|nuclear receptor subfamily 1 group I member 1|vitamin D nuclear receptor variant 1|vitamin D3 receptor

Position

12q13.11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vitamin D metabolism and pathway;PANTHER;P04396

Pathway

RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

Gene Expression;Reactome;REACT:71

Disease

pulmonary tuberculosis;GAD

Disease

combined bone mass;GAD

Disease

autoimmune hepatitis;GAD

Disease

HEMATOLOGICAL;GAD

Disease

Chronic Periodontitis;GAD

Disease

kidney stone disease;GAD

Disease

birth height growth to adolescence and adult stature;GAD

Disease

bone density;GAD

Disease

Osteoporosis;GAD

Disease

Difference in height;GAD

Disease

Crohn's disease;GAD

Disease

serum total and ionized calcium concentration;GAD

Disease

hepatitis B;GAD

Disease

obesity;GAD

Disease

early osteoarthritis;GAD

Disease

diabetes, type 2;GAD

Disease

AGING;GAD

Disease

Vitamin D deficiency rickets;GAD

Disease

leisure physical activity;GAD

Disease

chronic renal failure.;GAD

Disease

prostatic hyperplasia;GAD

Disease

Osteoporosis, Postmenopausal;GAD

Disease

BsmI vitamin D receptor gene polymorphism;GAD

Disease

osteonecrosis;GAD

Disease

renal cell carcinoma;GAD

Disease

breast cancer risk;GAD

Disease

bone metastases;GAD

Disease

calcific aortic valve stenosis;GAD

Disease

IMMUNE;GAD

Disease

Addison's disease;GAD

Disease

osteoarthritis;GAD

Disease

psoriasis;GAD

Disease

prostate cancer;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

METABOLIC;GAD

Disease

periodontitis;GAD

Disease

sex-dependent growth;GAD

Disease

INFECTION;GAD

Disease

Rickets, vitamin D-resistant, type IIA;OMIM

Disease

Nephrolithiasis;GAD

Disease

colorectal cancer;GAD

Disease

Bone Mineral Density;GAD

Disease

tuberculosis;GAD

Disease

radiographic osteoarthritis at the knee;GAD

Disease

benign prostatic hyperplasia and benign prostatic enlargement;GAD

Disease

diabetes, type 1;GAD

Disease

lead toxicity;GAD

Disease

primary biliary cirrhosis;GAD

Disease

CARDIOVASCULAR;GAD

Disease

malignant melanoma;GAD

Disease

arthritis, juvenile;GAD

Disease

calcium oxalate stone disease;GAD

Disease

CANCER;GAD

Disease

melanoma;GAD

Disease

NORMALVARIATION;GAD

Disease

dengue hemorrhagic fever;GAD

Disease

pregnancy loss, recurrent;GAD

Disease

fat-free mass and sarcopenia;GAD

Disease

hyperthyroidism;GAD

Disease

Osteoporosis, involutional;OMIM

Disease

REPRODUCTION;GAD

Disease

lumbar disc disease;GAD

Disease

periodontitis, early-onset;GAD

Disease

bone mass;GAD

Disease

leprosy type;GAD

Disease

multiple sclerosis;GAD

Disease

urolithiasis;GAD

Disease

calcium;GAD

Disease

breast cancer;GAD

Disease

juvenile idiopathic arthritis;GAD

Disease

betaCL osteocalcin;GAD

Disease

metastatic breast cancer;GAD

Disease

end stage renal disease;GAD

Disease

Calcium Nephrolithiasis;GAD

Disease

rickets;GAD

Disease

breast cancer development;GAD

Disease

RENAL;GAD

Disease

Progression to AIDS;GAD

Disease

Lupus;GAD

Disease

Grave`s disease;GAD

External Links

Links to Entrez Gene

7421

Links to all GeneRIF Items

7421

Links to iHOP

7421

Sequence Information

Nucleotide Sequence

>7421 : length: 1284
atggaggcaatggcggccagcacttccctgcctgaccctggagactttgaccggaacgtg
ccccggatctgtggggtgtgtggagaccgagccactggctttcacttcaatgctatgacc
tgtgaaggctgcaaaggcttcttcaggcgaagcatgaagcggaaggcactattcacctgc
cccttcaacggggactgccgcatcaccaaggacaaccgacgccactgccaggcctgccgg
ctcaaacgctgtgtggacatcggcatgatgaaggagttcattctgacagatgaggaagtg
cagaggaagcgggagatgatcctgaagcggaaggaggaggaggccttgaaggacagtctg
cggcccaagctgtctgaggagcagcagcgcatcattgccatactgctggacgcccaccat
aagacctacgaccccacctactccgacttctgccagttccggcctccagttcgtgtgaat
gatggtggagggagccatccttccaggcccaactccagacacactcccagcttctctggg
gactcctcctcctcctgctcagatcactgtatcacctcttcagacatgatggactcgtcc
agcttctccaatctggatctgagtgaagaagattcagatgacccttctgtgaccctagag
ctgtcccagctctccatgctgccccacctggctgacctggtcagttacagcatccaaaag
gtcattggctttgctaagatgataccaggattcagagacctcacctctgaggaccagatc
gtactgctgaagtcaagtgccattgaggtcatcatgttgcgctccaatgagtccttcacc
atggacgacatgtcctggacctgtggcaaccaagactacaagtaccgcgtcagtgacgtg
accaaagccggacacagcctggagctgattgagcccctcatcaagttccaggtgggactg
aagaagctgaacttgcatgaggaggagcatgtcctgctcatggccatctgcatcgtctcc
ccagatcgtcctggggtgcaggacgccgcgctgattgaggccatccaggaccgcctgtcc
aacacactgcagacgtacatccgctgccgccacccgcccccgggcagccacctgctctat
gccaagatgatccagaagctagccgacctgcgcagcctcaatgaggagcactccaagcag
taccgctgcctctccttccagcctgagtgcagcatgaagctaacgccccttgtgctcgaa
gtgtttggcaatgagatctcctga

Protein Sequence

>7421 : length: 427
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG
DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV
TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS



')