Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7227

Name

TRPS1

Synonym

GC79|LGCR;trichorhinophalangeal syndrome I;TRPS1;trichorhinophalangeal syndrome I

Definition

tricho-rhino-phalangeal syndrome type I protein|zinc finger protein GC79|zinc finger transcription factor Trps1

Position

8q24.12

Gene Type

protein-coding

External Links

Links to Entrez Gene

7227

Links to all GeneRIF Items

7227

Links to iHOP

7227

Sequence Information

Nucleotide Sequence

>7227 : length: 3885
atgccttatgaagtcaatgctgggtatgattttacaaatatggtccggaaaaagaacccc
cctctgagaaacgttgcaagtgaaggcgagggccagatcctggagcctataggtacagaa
agcaaggtatctggaaagaacaaagaattttctgcagatcagatgtcagaaaatacggat
cagagtgatgctgcagaactaaatcataaggaggaacatagcttgcatgttcaagatcca
tcttctagcagtaagaaggacttgaaaagcgcagttctgagtgagaaggctggcttcaat
tatgaaagccccagtaagggaggaaactttccctcctttccgcatgatgaggtgacagac
agaaatatgttggctttctcatctccagctgctgggggagtctgtgagcccttgaagtct
ccgcaaagagcagaggcagatgaccctcaagatatggcctgcaccccctcaggggactca
ctggagacaaaggaagatcagaagatgtcaccaaaggctacagaggaaacagggcaagca
cagagtggtcaagccaattgtcaaggtttgagcccagtttcagtggcctcaaaaaaccca
caagtgccttcagatgggggtgtaagactgaataaatccaaaactgacttactggtgaat
gacaacccagacccggcacctctgtctccagagcttcaggactttaaatgcaatatctgt
ggatatggttactacggcaacgaccccacagatctgattaagcacttccgaaagtatcac
ttaggactgcataaccgcaccaggcaagatgctgagctggacagcaaaatcttggccctt
cataacatggtgcagttcagccattccaaagacttccagaaggtcaaccgttctgtgttt
tctggtgtgctgcaggacatcaattcttcaaggcctgttttactaaatgggacctatgat
gtgcaggtgacttcaggtggaacattcattggcattggacggaaaacaccagattgccaa
gggaacaccaagtatttccgctgtaaattctgcaatttcacttatatgggcaactcatcc
accgaattagaacaacattttcttcagactcacccaaacaaaataaaagcttctctcccc
tcctctgaggttgcaaaaccttcagagaaaaactctaacaagtccatccctgcacttcaa
tccagtgattctggagacttgggaaaatggcaggacaagataacagtcaaagcaggagat
gacactcctgttgggtactcagtgcccataaagcccctcgattcctctagacaaaatggt
acagaggccaccagttactactggtgtaaattttgtagtttcagctgtgagtcatctagc
tcacttaaactgctagaacattatggcaagcagcacggagcagtgcagtcaggcggcctt
aatccagagttaaatgataagctttccaggggctctgtcattaatcagaatgatctagcc
aaaagttcagaaggagagacaatgaccaagacagacaagagctcgagtggggctaaaaag
aaggacttctccagcaagggagccgaggataatatggtaacgagctataattgtcagttc
tgtgacttccgatattccaaaagccatggccctgatgtaattgtagtggggccacttctc
cgtcattatcaacagctccataacattcacaagtgtaccattaaacactgtccattctgt
cccagaggactttgcagcccagaaaagcaccttggagaaattacttatccgtttgcttgt
agaaaaagtaattgttcccactgtgcactcttgcttctgcacttgtctcctggggcggct
ggaagctcgcgagtcaaacatcagtgccatcagtgttcattcaccacccctgacgtagat
gtactcctctttcactatgaaagtgtgcatgagtcccaagcatcggatgtcaaacaagaa
gcaaatcacctgcaaggatcggatgggcagcagtctgtcaaggaaagcaaagaacactca
tgtaccaaatgtgattttattacccaagtggaagaagagatttcccgacactacaggaga
gcacacagctgctacaaatgccgtcagtgcagttttacagctgccgatactcagtcacta
ctggagcacttcaacactgttcactgccaggaacaggacatcactacagccaacggcgaa
gaggacggtcatgccatatccaccatcaaagaggagcccaaaattgacttcagggtctac
aatctgctaactccagactctaaaatgggagagccagtttctgagagtgtggtgaagaga
gagaagctggaagagaaggacgggctcaaagagaaagtttggaccgagagttccagtgat
gaccttcgcaatgtgacttggagaggggcagacatcctgcgggggagtccgtcatacacc
caagcaagcctggggctgctgacgcctgtgtctggcacccaagagcagacaaagactcta
agggatagtcccaatgtggaggccgcccatctggcgcgacctatttatggcttggctgtg
gaaaccaagggattcctgcagggggcgccagctggcggagagaagtctggggccctcccc
cagcagtatcctgcatcgggagaaaacaagtccaaggatgaatcccagtccctgttacgg
aggcgtagaggctccggtgttttttgtgccaattgcctgaccacaaagacctctctctgg
cgaaagaatgcaaatggcggatatgtatgcaacgcgtgtggcctctaccagaagcttcac
tcgactcccaggcctttaaacatcattaaacaaaacaacggtgagcagattattaggagg
agaacaagaaagcgccttaacccagaggcacttcaggctgagcagctcaacaaacagcag
aggggcagcaatgaggagcaagtcaatggaagcccgttagagaggaggtcagaagatcat
ctaactgaaagtcaccagagagaaattccactccccagcctaagtaaatacgaagcccag
ggttcattgactaaaagccattctgctcagcagccagtcctggtcagccaaactctggat
attcacaaaaggatgcaacctttgcacattcagataaaaagtcctcaggaaagtactgga
gatccaggaaatagttcatccgtatctgaagggaaaggaagttctgagagaggcagtcct
atagaaaagtacatgagacctgcgaaacacccaaattattcaccaccaggcagccctatt
gaaaagtaccagtacccactttttggacttccctttgtacataatgacttccagagtgaa
gctgattggctgcggttctggagtaaatataagctctccgttcctgggaatccgcactac
ttgagtcacgtgcctggcctaccaaatccttgccaaaactatgtgccttatcccaccttc
aatctgcctcctcatttttcagctgttggatcagacaatgacattcctctagatttggcg
atcaagcattccagacctgggccaactgcaaacggtgcctccaaggagaaaacgaaggca
ccaccaaatgtaaaaaatgaaggtcccttgaatgtagtaaaaacagagaaagttgataga
agtactcaagatgaactttcaacaaaatgtgtgcactgtggcattgtctttctggatgaa
gtgatgtatgctttgcatatgagttgccatggtgacagtggacctttccagtgcagcata
tgccagcatctttgcacggacaaatatgacttcacaacacatatccagaggggcctgcat
aggaacaatgcacaagtggaaaaaaatggaaaacctaaagagtaa

Protein Sequence

>7227 : length: 1294
MPYEVNAGYDFTNMVRKKNPPLRNVASEGEGQILEPIGTESKVSGKNKEFSADQMSENTD
QSDAAELNHKEEHSLHVQDPSSSSKKDLKSAVLSEKAGFNYESPSKGGNFPSFPHDEVTD
RNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSLETKEDQKMSPKATEETGQA
QSGQANCQGLSPVSVASKNPQVPSDGGVRLNKSKTDLLVNDNPDPAPLSPELQDFKCNIC
GYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVF
SGVLQDINSSRPVLLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSS
TELEQHFLQTHPNKIKASLPSSEVAKPSEKNSNKSIPALQSSDSGDLGKWQDKITVKAGD
DTPVGYSVPIKPLDSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQHGAVQSGGL
NPELNDKLSRGSVINQNDLAKSSEGETMTKTDKSSSGAKKKDFSSKGAEDNMVTSYNCQF
CDFRYSKSHGPDVIVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFAC
RKSNCSHCALLLLHLSPGAAGSSRVKHQCHQCSFTTPDVDVLLFHYESVHESQASDVKQE
ANHLQGSDGQQSVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADTQSL
LEHFNTVHCQEQDITTANGEEDGHAISTIKEEPKIDFRVYNLLTPDSKMGEPVSESVVKR
EKLEEKDGLKEKVWTESSSDDLRNVTWRGADILRGSPSYTQASLGLLTPVSGTQEQTKTL
RDSPNVEAAHLARPIYGLAVETKGFLQGAPAGGEKSGALPQQYPASGENKSKDESQSLLR
RRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRR
RTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQ
GSLTKSHSAQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSP
IEKYMRPAKHPNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHY
LSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKA
PPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSI
CQHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE



')