Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

7161

Name

TP73

Synonym

P73;tumor protein p73;TP73;tumor protein p73

Definition

p53-like transcription factor|p53-related protein

Position

1p36.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

atm signaling pathway;PID BioCarta;100235

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

p53 pathway;PANTHER;P00059

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

p53 pathway by glucose deprivation;PANTHER;P04397

Pathway

P53 pathway feedback loops 1;PANTHER;P04392

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

Huntington disease;PANTHER;P00029

Disease

Drug abuse;FunDO

Disease

Cancers;KEGG DISEASE

Disease

esophageal cancer;GAD

Disease

Fanconi's anemia;FunDO

Disease

lung cancer;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

breast cancer;GAD

Disease

Hepatocellular carcinoma;KEGG DISEASE;H00048

Disease

head and neck cancer;GAD

Disease

endometrial cancer;GAD

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

esophageal cancer gastric cardiac cancer;GAD

Disease

Neuroblastoma;OMIM

Disease

Leukoencephalopathy;FunDO

External Links

Links to Entrez Gene

7161

Links to all GeneRIF Items

7161

Links to iHOP

7161

Sequence Information

Nucleotide Sequence

>7161 : length: 1764
atgctgtacgtcggtgaccccgcacggcacctcgccacggcccagttcaatctgctgagc
agcaccatggaccagatgagcagccgcgcggcctcggccagcccctacaccccagagcac
gccgccagcgtgcccacccactcgccctacgcacaacccagctccaccttcgacaccatg
tcgccggcgcctgtcatcccctccaacaccgactaccccggaccccaccactttgaggtc
actttccagcagtccagcacggccaagtcagccacctggacgtactccccgctcttgaag
aaactctactgccagatcgccaagacatgccccatccagatcaaggtgtccaccccgcca
cccccaggcaccgccatccgggccatgcctgtttacaagaaagcggagcacgtgaccgac
gtcgtgaaacgctgccccaaccacgagctcgggagggacttcaacgaaggacagtctgct
ccagccagccacctcatccgcgtggaaggcaataatctctcgcagtatgtggatgaccct
gtcaccggcaggcagagcgtcgtggtgccctatgagccaccacaggtggggacggaattc
accaccatcctgtacaacttcatgtgtaacagcagctgtgtagggggcatgaaccggcgg
cccatcctcatcatcatcaccctggagatgcgggatgggcaggtgctgggccgccggtcc
tttgagggccgcatctgcgcctgtcctggccgcgaccgaaaagctgatgaggaccactac
cgggagcagcaggccctgaacgagagctccgccaagaacggggccgccagcaagcgtgcc
ttcaagcagagcccccctgccgtccccgcccttggtgccggtgtgaagaagcggcggcat
ggagacgaggacacgtactaccttcaggtgcgaggccgggagaactttgagatcctgatg
aagctgaaagagagcctggagctgatggagttggtgccgcagccactggtggactcctat
cggcagcagcagcagctcctacagaggccgagtcacctacagcccccgtcctacgggccg
gtcctctcgcccatgaacaaggtgcacgggggcatgaacaagctgccctccgtcaaccag
ctggtgggccagcctcccccgcacagttcggcagctacacccaacctggggcccgtgggc
cccgggatgctcaacaaccatggccacgcagtgccagccaacggcgagatgagcagcagc
cacagcgcccagtccatggtctcggggtcccactgcactccgccacccccctaccacgcc
gaccccagcctcgtcagttttttaacaggattggggtgtccaaactgcatcgagtatttc
acctcccaagggttacagagcatttaccacctgcagaacctgaccattgaggacctgggg
gccctgaagatccccgagcagtaccgcatgaccatctggcggggcctgcaggacctgaag
cagggccacgactacagcaccgcgcagcagctgctccgctctagcaacgcggccaccatc
tccatcggcggctcaggggaactgcagcgccagcgggtcatggaggccgtgcacttccgc
gtgcgccacaccatcaccatccccaaccgcggcggcccaggcggcggccctgacgagtgg
gcggacttcggcttcgacctgcccgactgcaaggcccgcaagcagcccatcaaggaggag
ttcacggaggccgagatccactga

Protein Sequence

>7161 : length: 587
MLYVGDPARHLATAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTM
SPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPP
PPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDP
VTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRS
FEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRH
GDEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGP
VLSPMNKVHGGMNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSS
HSAQSMVSGSHCTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLG
ALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFR
VRHTITIPNRGGPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH



')